KEGG   Pan troglodytes (chimpanzee): 748225
Entry
748225            CDS       T01005                                 

Gene name
PTPN11
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11 isoform X1
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04014  Ras signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04360  Axon guidance
ptr04625  C-type lectin receptor signaling pathway
ptr04630  JAK-STAT signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04670  Leukocyte transendothelial migration
ptr04722  Neurotrophin signaling pathway
ptr04920  Adipocytokine signaling pathway
ptr04931  Insulin resistance
ptr05168  Herpes simplex virus 1 infection
ptr05205  Proteoglycans in cancer
ptr05211  Renal cell carcinoma
ptr05220  Chronic myeloid leukemia
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    748225 (PTPN11)
   04630 JAK-STAT signaling pathway
    748225 (PTPN11)
   04072 Phospholipase D signaling pathway
    748225 (PTPN11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    748225 (PTPN11)
   04650 Natural killer cell mediated cytotoxicity
    748225 (PTPN11)
   04670 Leukocyte transendothelial migration
    748225 (PTPN11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    748225 (PTPN11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    748225 (PTPN11)
  09158 Development and regeneration
   04360 Axon guidance
    748225 (PTPN11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    748225 (PTPN11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    748225 (PTPN11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    748225 (PTPN11)
   05211 Renal cell carcinoma
    748225 (PTPN11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    748225 (PTPN11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    748225 (PTPN11)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     748225 (PTPN11)
Protein phosphatases and associated proteins [BR:ptr01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    748225 (PTPN11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 748225
NCBI-ProteinID: XP_016779774
LinkDB
Position
12
AA seq 597 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQALLQGNTERTVW
QYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILI
DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSK
RKGHEYTNIKYSLADQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcacccaaatatcactggtgtggaggcagaaaacctactg
ttgacaagaggagttgatggcagttttttggcaaggcctagtaaaagtaaccctggagac
ttcacactttccgttagaagaaatggagctgtcacccacatcaagattcagaacactggt
gattactatgacctgtatggaggggagaaatttgccactttggctgagttggtccagtat
tacatggaacatcacgggcaattaaaagagaagaatggagatgtcattgagcttaaatat
cctctgaactgtgcagatcctacctctgaaaggtggtttcatggacacctctctgggaaa
gaagcagagaaattattaactgaaaaaggaaaacatggtagttttcttgtacgagagagc
cagagccaccctggagattttgttctttctgtgcgcactggtgatgacaaaggggagagc
aatgacggcaagtctaaagtgacccatgttatgattcgctgtcaggaactgaaatacgac
gttggtggaggagaacggtttgattctttgacagatcttgtggaacattataagaaaaat
cctatggtggaaacattgggtacagtactacaactcaagcagccccttaacacgactcgt
ataaatgctgctgaaatagaaagcagagttcgagaactaagcaaattagctgagaccaca
gataaagtcaaacaaggcttttgggaagaatttgagacactacaacaacaggagtgcaaa
cttctctacagccgaaaagagggtcaaaggcaagaaaacaaaaacaaaaatagatataaa
aacatcctgccctttgatcataccagggttgtcctacacgatggtgatcccaatgagcct
gtttcagattacatcaatgcaaatatcatcatgcctgaatttgaaaccaagtgcaacaat
tcaaagcccaaaaagagttacattgccacacaaggctgcctgcaaaacacggtgaatgac
ttttggcggatggtgttccaagaaaactcccgagtgattgtcatgacaacgaaagaagtg
gagagaggaaagagtaaatgtgtcaaatactggcctgatgagtatgctctaaaagaatat
ggcgtcatgcgtgttaggaacgtcaaagaaagcgccgctcatgactatacgctaagagaa
cttaaactttcaaaggttggacaagctctactccaggggaatacggagagaacggtctgg
caataccactttcggacctggccggaccacggcgtacccagcgaccccgggggcgtgctg
gacttcctggaggaggtgcaccataagcaggagagcatcatggatgcagggccggtcgtg
gtgcactgcagtgctggaattggccggacagggacgttcattgtgattgatattcttatt
gacatcatcagagagaaaggtgttgactgcgatattgacgttcccaaaaccatccagatg
gtgcggtctcagaggtcagggatggtccagacagaagcacagtaccgatttatctatatg
gcggtccagcattatattgaaacactacagcgcaggattgaagaagagcagaaaagcaag
aggaaagggcacgaatatacaaatattaagtattctctagcggaccagacgagtggagat
cagagccccctcccgccttgtactccaacgccaccctgtgcagaaatgagagaagacagt
gctagagtctatgaaaacgtgggcctgatgcaacagcagaaaagtttcagatga

DBGET integrated database retrieval system