KEGG   Pan troglodytes (chimpanzee): 748918
Entry
748918            CDS       T01005                                 

Gene name
GAB2
Definition
(RefSeq) GRB2-associated-binding protein 2 isoform X1
  KO
K08091  GRB2-associated-binding protein 2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04014  Ras signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04380  Osteoclast differentiation
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    748918 (GAB2)
   04072 Phospholipase D signaling pathway
    748918 (GAB2)
   04071 Sphingolipid signaling pathway
    748918 (GAB2)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    748918 (GAB2)
   04666 Fc gamma R-mediated phagocytosis
    748918 (GAB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    748918 (GAB2)
 09160 Human Diseases
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    748918 (GAB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ptr04990]
    748918 (GAB2)
Domain-containing proteins not elsewhere classified [BR:ptr04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   748918 (GAB2)
SSDB
Motif
Pfam: PH PH_11 PH_9 PH_3 PH_2 PH_8 PH_13
Other DBs
NCBI-GeneID: 748918
NCBI-ProteinID: XP_001164121
Ensembl: ENSPTRG00000004115
VGNC: 11785
UniProt: H2R3E1 A0A6D2WZQ6
LinkDB
Position
11
AA seq 676 aa
MSGGGDVVCTGWLRKSPPEKKLRRYAWKKRWFILRSGRMSGDPDVLEYYKNDHSKKPLRI
INLNFCEQVDAGLTFNKKELQDSFVFDIKTSERTFYLVAETEEDMNKWVQSICQICGFNQ
AEESTDSLRNVSSAGHGPRSSPAELSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHM
QPTLSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNG
ISGQVHGFYSLPKPSRHNTEFRDSTYDLPRSLASHGHTKGSLTGSETDNEDVYTFKTPSN
TLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNAMTVATPGDSAIAPPPRPPKPSQ
AETPRWGSPQQRPPISENSRSVAATIPRRNTLPAMDNSRLHRASSCETYEYPQRGGESAG
RSAESMSDGVGSFLPGKMTVGRSDSTNSEDNYVPMNPGSSTLLAMERAGDNSQSVYIPMS
PGAHHFDSLGYPSTTLPVHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELP
FKSPITKSWSRANHTFNSSSSQYCRPISTQSITSTDSGDSEENYVPMQNPVSASPVPSGT
NSPAPKKSTGSVDYLALDFQPSSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTMQE
WTDVRQSSEPSKGAKL
NT seq 2031 nt   +upstreamnt  +downstreamnt
atgagcggcggcggcgacgtggtgtgcaccggctggctgaggaaatcgcctcccgagaag
aagttgaggcgctatgcctggaagaaacgctggtttatcctgcggagtggccggatgagc
ggtgacccagatgttctggaatactacaagaacgatcactccaagaagcctctgcggatc
atcaacctgaacttctgtgagcaggtagatgcaggcctgacctttaacaagaaggagctg
caggatagttttgtgtttgacatcaagaccagtgaacgcaccttttacctggtggctgag
acagaagaggacatgaataagtgggtccagagcatctgccagatctgtggcttcaatcag
gctgaggagagcacagactccctgagaaatgtttcctcagccggtcatggcccccgctct
tctccagctgagctcagcagctctagccagcaccttctccgagagcgcaagtcctcagcc
ccgtcacactccagccagccaactctgttcacgtttgaaccccctgtgtcaaaccacatg
cagcccaccttgtccaccagcgcacctcaggagtatctctacttgcaccagtgcataagc
cgaagagcagaaaatgcaaggagtgccagcttctctcagggcaccagagcctcttttctc
atgaggagtgacacagctgtacaaaaacttgcccagggcaatggacactgtgtcaacggg
atcagtggtcaagtccatggcttctatagccttcccaagccgagccggcacaatacagaa
ttcagagacagtacctacgacctcccccgcagcctggcctcccatggccacaccaagggc
agcctcacaggctctgagacagataatgaggatgtgtacaccttcaagacgcccagcaac
accctgtgcagggagtttggggacctcctcgtagacaatatggatgttccggccacccca
ctctcagcctaccagatccctaggacattcactctggacaaaaaccacaatgccatgaca
gtggccactcctggggactcagccatagctcccccaccccgcccccccaagccaagtcag
gcagaaacacctcgatggggcagtcctcagcagagaccgccaatcagtgaaaatagcaga
tctgtcgctgccaccatccccagacgcaacaccctccctgcaatggacaacagccgactt
caccgagcttcttcctgtgagacctacgagtacccacagcgtggtggagagagtgcaggc
cggtctgctgaatccatgagtgatggagtcggctctttcctgccagggaaaatgactgtg
ggccgatcagacagcaccaattctgaagacaactatgtgcccatgaatccaggttcttcc
accctgttggccatggaacgagcaggtgataattcccagagcgtctacatcccaatgagc
ccaggggcccatcactttgactcacttggctacccatcaacaactcttcctgtgcaccga
ggccccagcagaggaagtgagattcagccaccccctgtcaaccgcaacctcaaacctgat
cggaaagcaaagccaacaccacttgacctgagaaacaacaccgtcatcgatgaactcccc
ttcaagtcacctatcaccaagtcttggtctagggccaaccacaccttcaactccagctcc
tcccagtactgccgccccatctccacccagagcatcaccagcacagactcaggagacagc
gaagagaactatgtccctatgcaaaacccagtgtctgcatctcccgttcccagtggcacg
aacagtcctgcccctaagaagagcaccggcagcgttgattatctggccctggacttccag
ccgagctccccaagcccccaccgcaagccatctacttcatccgtcacttctgatgagaag
gtggactacgttcaggtggacaaggagaagacccaggccctgcagaacaccatgcaggag
tggacagacgtgcggcagtcctcggagccttccaagggtgccaagctgtga

DBGET integrated database retrieval system