KEGG   Paraburkholderia terricola: CUJ90_01275Help
Entry
CUJ90_01275       CDS       T05812                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pts  Paraburkholderia terricola
Pathway
pts00071  Fatty acid degradation
pts00280  Valine, leucine and isoleucine degradation
pts00281  Geraniol degradation
pts00310  Lysine degradation
pts00360  Phenylalanine metabolism
pts00362  Benzoate degradation
pts00380  Tryptophan metabolism
pts00410  beta-Alanine metabolism
pts00627  Aminobenzoate degradation
pts00640  Propanoate metabolism
pts00650  Butanoate metabolism
pts00903  Limonene and pinene degradation
pts00930  Caprolactam degradation
pts01100  Metabolic pathways
pts01110  Biosynthesis of secondary metabolites
pts01120  Microbial metabolism in diverse environments
pts01130  Biosynthesis of antibiotics
pts01212  Fatty acid metabolism
Module
pts_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CUJ90_01275
   00650 Butanoate metabolism
    CUJ90_01275
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CUJ90_01275
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CUJ90_01275
   00310 Lysine degradation
    CUJ90_01275
   00360 Phenylalanine metabolism
    CUJ90_01275
   00380 Tryptophan metabolism
    CUJ90_01275
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CUJ90_01275
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CUJ90_01275
   00281 Geraniol degradation
    CUJ90_01275
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CUJ90_01275
   00627 Aminobenzoate degradation
    CUJ90_01275
   00930 Caprolactam degradation
    CUJ90_01275
Enzymes [BR:pts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CUJ90_01275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AXE91140
LinkDB All DBs
Position
mHS1_A:285057..285953
Genome map
AA seq 298 aa AA seqDB search
MSHAPYRNDAHYAHYQALQLHRHPHGVLEVVMSGEGANRSALATADARMHFELAEIWRDI
DRDPQVRVAIIRGEGKGFSAGGDLQLVEDMATDFDVRARVWREARDLVYNVINCSKPIVS
AMHGPAVGAGLVAGLLADISIAAKTARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYYL
MLCEPVSGAEAERIGLVSLAVDENDLLPKAFEVARKLADGSQTAIRWTKYALNNWLRSAG
PAFDTSLALEFMGFAGPDVREGVSSLRERRAPDFGGADPWSGRPQKSARGAASDDENS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacgcaccctatcgcaacgacgcgcattacgcgcactaccaggcgcttcaattg
caccgccatccgcacggcgtgctcgaagtcgtgatgagcggcgagggcgcgaaccgcagc
gcactcgccaccgccgacgcgcggatgcatttcgagctcgccgaaatctggcgcgacatc
gatcgggatcctcaagtgcgtgtcgcgatcattcgcggcgaaggcaagggcttttcggcg
ggcggcgatctgcaactggtcgaggacatggcgaccgatttcgacgtgcgcgcgcgcgtg
tggcgcgaggcacgcgatctggtctacaacgtcatcaactgcagcaagccgatcgtctcg
gcgatgcacggcccggcggtcggcgcggggctcgtggcgggcctgctcgccgatatctcg
atcgcggcgaagacggcgcgcatcatcgacgggcatacgcgtctgggcgtcgccgccggc
gatcacgcggcgatcgtctggccgctgctgtgcggcatggcgaaagcgaagtattacctg
atgctgtgcgagccggtgagcggcgcggaagcggagcggatcggcctcgtatcgctcgcg
gtcgacgaaaacgatctgctgcccaaggccttcgaggtcgcgcgcaaactggccgacggc
tcgcaaacggcgattcgctggaccaagtatgcgttgaacaactggctgcgctcggcgggg
ccggcgttcgatacgtcgctcgcgctggagttcatggggtttgccgggccggatgtgcgc
gaaggcgtgagttcgctgcgcgagcggcgcgcgcccgacttcggcggagcggatccgtgg
agtgggcggccgcaaaagtcggcccgcggcgctgcgtcggacgacgagaattcctga

DBGET integrated database retrieval system