KEGG   Paraburkholderia terricola: CUJ90_08790Help
Entry
CUJ90_08790       CDS       T05812                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
pts  Paraburkholderia terricola
Pathway
pts00550  Peptidoglycan biosynthesis
pts01100  Metabolic pathways
pts01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pts00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CUJ90_08790
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CUJ90_08790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pts01003]
    CUJ90_08790
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pts01011]
    CUJ90_08790
Enzymes [BR:pts01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     CUJ90_08790
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CUJ90_08790
Glycosyltransferases [BR:pts01003]
 Polysaccharide
  Bacterial polysaccharide
   CUJ90_08790
Peptidoglycan biosynthesis and degradation proteins [BR:pts01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   CUJ90_08790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AXE92439
LinkDB All DBs
Position
mHS1_A:1953915..1956458
Genome map
AA seq 847 aa AA seqDB search
MTRLINRFLQTLDKGLTLANPLVAGAWWHMRHPTRRGVARACAALPVLLLLYVLILIPFT
PGIGDIRKAKSEQPAQILSADGKLLAEFKPSNREWVKLKDISPNVVNALIATEDHRFYQH
FGLDWRRTASAALHTFSGDRQGGSTITQQLARNLYPDEIGRAPTLTRKLKEAITAFKIEA
LYTKDEILETYLNTVPFLYNAYGIEMAARTYFDKSASELNVLESATLAGMLKGNSYYNPV
LNPERALQRRNTVLAQMVKYGKLTPAAYETLKRRALRIDFERQTEPPGPAPHFAQQLRKW
LAAWADRNDYNIYSDGLVVRTTIDSRLQTMATQAVILQGNQLQGIANSAWGTRAGCANGR
DLLPTFLRETPEYRAAKDAGMTDEDALKRLSSDHHLVQALCESKTRVQADFLAMDPRNGQ
IKAWVGSRDFSQDPFDHVQQARRQPGSTFKPFVYAAAFESGAKPTDTLPDKPVEIALAGG
EIWRPSDEDEPSERAISLRDGLAFSRNRITAQLMETVGPTKVARLARAMGVRDSTLDPVP
SLALGTSPVTLKEMVSAYGTIANLGGYVEPVMVTRIEDRNGEVLAEFAPAPPRQELSGDA
ARTLVDVMRDVVSRGTGSSIRSRFGVRGDVAGKTGTTQGNADGWFILIHPQLVAGAWVGF
NDSRVTLRSDYWGQGAHSALPIVGDFFQRAQRSKLVDTRVKFETEQEPGWFAERTDRLRA
WFEHLFAASPGQSEAPLVRREPARRAPGGSAASAALGVSGASAASGALGASGASGTLAEP
REVPQPPLLSAPASAPRFASGAVDGEVRGGGEPALAPTPTPDDVTPPDAGSPANALPAAP
ASAGGAP
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgcctgatcaaccgattcctacagaccctcgacaaagggctgaccctcgcgaac
ccgctggtcgccggggcctggtggcatatgcggcatcccacccgccgcggcgtggcaagg
gcttgcgccgcgcttccggtgctgctgcttctctacgtgctgatcctgattccgttcacg
ccgggcatcggcgacatccgcaaggcgaagagcgagcagcccgcgcaaatcctgtcggcg
gacggcaagctgctggccgaattcaagccgtcgaaccgcgagtgggtcaagctcaaggac
atctcgccgaatgtggtgaacgcgctgatcgcgaccgaagaccatcgcttctaccagcat
ttcgggctcgactggcggcgcacggcctcggccgcgctgcatacgttttccggcgaccgc
cagggcggctcgaccatcacgcagcaactcgcgcgcaatctctatcccgacgaaatcggc
cgcgcgccgacgctgacccgcaagctcaaggaagcgatcacggcgttcaagatcgaggcg
ctctacaccaaggacgaaatcctcgaaacctacctgaataccgtgccgtttctctacaac
gcctacggcatcgagatggccgcgcggacttacttcgacaaatcggcctcggaactgaac
gtgctggaaagcgcgacgcttgccggcatgctcaagggcaacagctactacaacccggtg
ctgaaccccgagcgcgccttgcagcggcgcaacacggtgctcgcgcaaatggtcaagtac
ggcaagctcacgcccgccgcctacgagacgctcaagcgccgcgcgctgcgcatcgatttc
gagcggcagaccgagccgcccggacccgcgccgcatttcgcgcagcaattgcgcaagtgg
ctcgcggcctgggccgatcgcaacgactacaacatctattccgatgggctggtggtgcgc
accaccatcgattcgcgcttgcagaccatggcgacccaggcggtgattctgcagggcaac
cagttgcagggcatcgcgaactcggcgtggggcacgcgcgccggttgcgcgaacggccgg
gacctgttgccaacgttcctgcgcgaaacgcccgagtatcgcgccgcgaaagacgcgggc
atgaccgacgaggacgcgctgaagcgcctttcgtccgaccatcacctcgtgcaggcgctg
tgcgagagcaaaacccgcgtgcaggccgactttctcgcgatggacccgcgcaacggccag
atcaaggcgtgggtcggcagccgcgacttcagccaggatccgttcgatcacgttcagcag
gcgcggcgtcagccgggatcgaccttcaagccgttcgtctacgccgcggccttcgaaagc
ggcgcgaagccgaccgacacgctgcccgacaagcccgtcgaaatcgcgctggccggcggc
gaaatctggcgtccgagcgacgaggacgaaccgagcgaacgcgccatcagcctgcgcgac
ggcctcgctttttcgcgcaaccgcatcaccgcgcaactgatggagacggtcggtccgacc
aaggtcgcgagactggcgcgcgcgatgggcgtgcgcgacagcacgctcgatccggtgccg
tcgctcgcgctcggcacgagccccgtcacgctgaaggaaatggtgtcggcctacggcacg
atcgccaatttgggcggctacgtggagccggtgatggtcacgcgcatcgaggatcgcaac
ggcgaggtgctggccgagttcgcgcccgcgccgcccagacaggaactgtccggcgacgcc
gcgcgcacgctcgtcgacgtgatgcgcgacgtcgtgagccgcggcacggggtcgagcatt
cgcagccgcttcggcgtgcgcggcgacgtcgcgggcaagacgggcacgacccagggcaat
gcggacggctggttcatcctgattcatccgcaactcgtggcgggcgcgtgggtcgggttc
aacgacagccgcgtgaccttgcgcagcgactactgggggcagggggcgcatagcgcgctg
ccgatcgtcggcgatttcttccagcgcgcgcagcgctcgaagctggtcgatacccgcgtg
aagttcgagaccgagcaggagccaggctggtttgccgagcgcaccgaccggctgcgggcg
tggttcgagcatctgttcgcggcgtcgccgggtcagagcgaggcgccgctggtgcggcgc
gagccggcgcgccgtgcgcctggcgggtctgcggcgagtgctgcgttgggtgtgtccggt
gcttcggcggcgtccggcgcgttgggtgcatccggtgcatccggtacattggctgagccg
cgcgaagtgccgcaaccgccgctgctttccgcgccggcatccgcgccgaggttcgcgagc
ggggcggtcgatggcgaggtgcgtggcggcggcgaaccggcattggcgccgacgcccacg
ccggacgacgtgaccccgcccgatgcgggcagcccggccaatgcgctgccggctgcgccg
gcaagcgccggtggtgcgccgtga

DBGET integrated database retrieval system