KEGG   Paraburkholderia terricola: CUJ90_08820Help
Entry
CUJ90_08820       CDS       T05812                                 

Definition
(GenBank) peptidase S13
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
pts  Paraburkholderia terricola
Pathway
pts00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pts00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CUJ90_08820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pts01002]
    CUJ90_08820
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pts01011]
    CUJ90_08820
Enzymes [BR:pts01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CUJ90_08820
   3.4.21  Serine endopeptidases
    3.4.21.-  
     CUJ90_08820
Peptidases and inhibitors [BR:pts01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   CUJ90_08820
Peptidoglycan biosynthesis and degradation proteins [BR:pts01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CUJ90_08820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Laminin_G_3
Motif
Other DBs
NCBI-ProteinID: AXE92444
LinkDB All DBs
Position
mHS1_A:complement(1960386..1962041)
Genome map
AA seq 551 aa AA seqDB search
MRAQFPPILALVVACALVAGCGSDLSVVPPVDPIAQIMNKPRYTSAKSQWSMVVMDASTG
QVLDSLQPDTLFLTGSVRKLYSVGTALDLLGADHRFQTPVYRNGTLDASGKLTGDLILKA
SGDLTFGGRQKPDGTIDFTDFDHNEARGFNGAILTPEDPLTALNDLAAQVRASGITAVSG
DVIVDDRLFDAFRVPNGNVLISPILVNENLIDVTLAPGASAGQPGALDWRPRTSAMTLQG
TTITTAAQSGGGAMGAADIVVSGDAFDAGPLSCLAAPGCTATVSGEAGLGSPASISLGYV
SPLVGNPLCVSNLRVEDPPSFARTAFIDALARAGVTVSAPAVQRNASARLPSAQTYSAAT
QVASFTSLPYSELSKLILKVSLNTGANLSLMYQGLAQGVRTVGDALSTERKYLTGTLGLD
GAGFDFPSNGSGTPDSRATARTTATLLTTMSRRPIQAAYRNALPILGVDGSLAAIGNDVE
GKQHILVKSGATVSNGQMIAMNMAGYIDAKSGRRLAYALFVNNAGPVAALTDTLEVFDDE
ARILGIVYAKY
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcacagttcccgccaattctggcgttggtggtcgcctgcgcgctcgtcgccggt
tgcggcagcgacctttcggtcgttcctccggtcgatcccatcgcgcagatcatgaacaag
ccgcgctacacgagcgcgaaatcacaatggtcgatggtggtcatggacgcgagcacgggc
caggtgctcgactcgttgcaaccggacaccctgttcctgacgggctcggtgcgcaagctg
tactcggtgggcacggcgctagacctgctcggcgcggaccatcgctttcaaacgcccgtc
taccggaacggcacgctcgacgcgtccggcaagctgaccggcgacctgatcctcaaagcg
tccggcgacctgacgttcggcggacggcaaaaacccgacggcaccatcgatttcaccgac
ttcgaccacaacgaggcgcgcggctttaacggcgcaatcctgacgcccgaagatccgctg
accgcgctgaacgatttggccgcgcaggttcgagcgtccggcatcacggccgtcagcggc
gatgtcatcgtcgatgaccgtctgttcgatgcgtttcgcgtgccgaacggcaacgtgctg
atctcgccgatactcgtcaacgaaaatctgatcgacgtgacgctggctccgggcgcgagc
gcgggacagcccggcgcgctggactggcggccacgcaccagcgcgatgaccctgcagggc
accaccatcacgacggcggcgcaaagcgggggcggcgcaatgggcgcggcggacatcgtc
gtatccggcgacgcgttcgatgcagggccgctcagttgtctggctgcgcccggctgcacg
gcaaccgtgtcgggcgaggccggcctcggctcgccggcgtcgatttctctcggctacgtg
tcgccgctcgtcggcaaccctctgtgcgtgagcaatctgcgcgtcgaggacccgccttcc
tttgcccgcaccgcattcatcgatgcattggcgcgggccggcgtgacggtgtcggcgccc
gccgtgcagcgcaacgcgtcggcccgtttgccgtcggcgcaaacctactcggccgccaca
caggtcgcgagcttcacgtccctaccctattcggagttatcgaaactgattctgaaggtg
agcctgaacacgggcgcgaacctgagcctgatgtatcagggtcttgcgcaaggcgtcaga
accgtgggtgacgcgctctccaccgagcgcaagtatctgacgggcacgctcggcctcgac
ggtgcgggcttcgactttccgagcaatggcagcggcacgcccgacagccgcgcgacggcc
cgcacgacggcgacgctgctgaccacgatgagccgccggccgatccaggcggcgtatcgg
aacgccctgccgattctcggcgtcgacggttccctcgcggccatcggcaacgatgtggaa
ggcaagcagcatattctcgtgaagagcggcgcgaccgtctccaacggccagatgatcgcg
atgaacatggcgggctacatcgacgcgaaaagcggacgccgcctcgcctatgcgctcttc
gtcaacaacgccggtcccgtcgccgcgctcaccgacacgttggaggtgttcgacgacgaa
gcgcggattctcggcatcgtctatgcgaaatactga

DBGET integrated database retrieval system