KEGG   Paraburkholderia terricola: CUJ90_15880Help
Entry
CUJ90_15880       CDS       T05812                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pts  Paraburkholderia terricola
Pathway
pts00473  D-Alanine metabolism
pts00550  Peptidoglycan biosynthesis
pts01100  Metabolic pathways
pts01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pts00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CUJ90_15880
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CUJ90_15880
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CUJ90_15880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pts01011]
    CUJ90_15880
Enzymes [BR:pts01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CUJ90_15880
Peptidoglycan biosynthesis and degradation proteins [BR:pts01011]
 Precursor biosynthesis
  Amino acid ligase
   CUJ90_15880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST TTL ATP-grasp ATPgrasp_YheCD ATP-grasp_3 ATP-grasp_4 PPR
Motif
Other DBs
NCBI-ProteinID: AXE93638
LinkDB All DBs
Position
mHS1_A:complement(3542285..3543226)
Genome map
AA seq 313 aa AA seqDB search
MSSIDPKQFGKVAVLLGGDSAEREVSLNSGRLVLQGLRDAGIDAHPFDPAERPLAALKDE
GFVRAFNALHGGYGENGQIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQLGIPTPP
FEAVLRGDDYEARSHEIVAKLGLPLFVKPASEGSSVAVIKVKSADALPAALIEAVKYDRI
VVVEKSIEGGGEYTACIAGDLDLPVIRIVPAGEFYDYHAKYIANDTQYLIPCGLTADEEA
RLKVLARRAFDVLGCTDWGRADFMLDADGNPYFLEVNTAPGMTDHSLPPKAARAVGISYQ
ELVVGVLALTLKD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtatcgaccctaaacaattcggcaaggtggcagtgctgctcggtggcgattcc
gccgagcgcgaggtgtcgctcaattccggccgcctcgtgctgcaaggtctgcgcgacgcc
ggtatcgacgcgcatccgttcgatccggccgagcgtccgctcgccgcgttgaaggatgaa
ggcttcgtgcgcgcgttcaacgcgctgcacggcggctacggcgagaacggccagatccag
ggcgcactcgatttttacggcatccgctacacgggaagcggcgtgctcggctcggcgctc
ggtctcgacaagttccgcaccaagctcgtgtggcagcaactgggcattccgacgccgccg
ttcgaagccgtgctgcgcggcgacgactacgaagcgcgctcccacgagatcgtcgcgaag
ctcggcttgccgctcttcgtgaagccggcgagcgaagggtcgagcgtcgcggtgatcaag
gtgaagagcgccgacgcattgccggcggcgctgatcgaagcggtcaagtacgacaggatc
gtggtggtcgaaaagagcatcgagggcggcggcgagtacaccgcgtgcatcgccggcgat
ctcgacctgccggtgatccgcatcgtgccggccggcgaattctacgactatcacgcgaag
tacatcgccaacgacacgcaatacctgattccgtgcggcctgacggcggatgaggaagcg
cgtctgaaagtgctggcgcgccgcgcgttcgacgtgctcggctgcaccgattggggccgc
gccgatttcatgctcgacgccgacggcaacccgtacttcctggaagtgaacacggcgccc
ggcatgaccgatcactcgctgccgccgaaagcggcgcgcgcggtgggcatcagctatcag
gaactggtcgtcggcgtgttggcgctgaccttgaaggactga

DBGET integrated database retrieval system