KEGG   Paraburkholderia terricola: CUJ90_26940
Entry
CUJ90_26940       CDS       T05812                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pts  Paraburkholderia terricola
Pathway
pts00440  Phosphonate and phosphinate metabolism
pts00998  Biosynthesis of various secondary metabolites - part 2
pts01100  Metabolic pathways
pts01110  Biosynthesis of secondary metabolites
pts01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pts00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    CUJ90_26940 (aepX)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    CUJ90_26940 (aepX)
Enzymes [BR:pts01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     CUJ90_26940 (aepX)
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NAD_binding_7 NTP_transferase
Other DBs
NCBI-ProteinID: AXE95897
LinkDB
Position
mHS1_B:1875790..1877520
AA seq 576 aa
MNAREPAFVSASRSARLRQMLVSNELEFMMEAHNGLSARIVREAGFKAIWGSGLAISAQF
GVRDNNEASWTQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADMDEFCGKIKAGKDSQSDENFSIVARVEALIAGWGMDEALR
RAEAYRRAGADAILIHSKLSRPDEILEFAREWAGRGPLVIVPTKYYSTPTEVFREAGIST
VIWANHLIRAATSAMQAVAKEIHSSQTLVNVEDSIAAVNEIFRLQDADEYSEAEDRYLTS
GRAAGSAVVLAASRGAGLEAVTEDRPKVMLPIAGKPLLRWLVDAFKKQGVNDITVVGGYR
ADAIDTAGIKLVVNERHAQTGELASLACAVQGDKLAGDTVISYGDLLFRSYILRDLVESE
AAFSVVVDSSLTDAENASVRDFAWCSAADDRGLFGNKVTLRHVSSGQEASSAIASQTPHG
RWVGLLNVRGEGRERLQAVLGQLQARPDFDSLDMPALLNALIEAGESIEVQYVHGHWRGV
NDLEDFRRAGDFAHAQAPFAATAGNKAADATGGAAQ
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgaacgcccgcgaacccgcattcgtttccgcttcccgcagcgcgcgcctgcgccagatg
ctggtcagcaacgaactcgaattcatgatggaggcgcacaacggcctctccgcgcgcatt
gtccgcgaagccggctttaaagccatctggggctccggcctcgccatctccgcgcaattc
ggcgtacgcgacaataacgaagcaagctggacgcaagtcgtcgacaacctcgaattcatg
gccgacgccagcgacctgccgattctgctcgacggcgacaccggctacggcaacttcaac
aacgtgcgccgtctggtgcgcaaactcgaacagcgcggcatcgccggcgtgtgtatcgag
gacaagcaatttcccaagaccaatagcttcatcaacggcgaagcgcagccgctcgccgac
atggacgagttctgcggcaagatcaaggccggcaaggactcgcagtcggacgaaaacttt
tcgatcgtcgcgcgcgtcgaggcgttgatcgccggttggggcatggacgaagcgctgcgt
cgcgcggaagcctatcgccgcgccggcgcggacgcgatcctgattcacagcaagctctcg
cgtcccgacgaaatcctggagttcgcgcgcgaatgggccggccgcggtccgctcgtgatc
gtgccgaccaagtactacagcacgcccaccgaggtattccgcgaagccggcatcagcacc
gtgatctgggcgaatcacctgattcgcgcggccacctcggcaatgcaggccgtcgccaag
gaaattcattcgagccagacgctcgtgaacgtcgaggacagcattgccgccgtcaacgaa
attttccgcctgcaagacgccgacgaatactcggaagccgaagaccgctatctgacgagc
ggccgcgcggccggttcggcggtggtgctcgcggcgagccgcggcgcgggcctcgaagcc
gtcaccgaggaccgtccgaaggtcatgctgccgatcgccggcaaaccgctgctgcgctgg
ctcgtcgatgcgttcaagaagcagggtgtaaacgacatcacggtggtcggcggttatcgc
gcggacgcgatcgacacggcgggcatcaagctggtcgtcaacgaacggcatgcgcaaacc
ggcgaactggcgtcgctcgcttgcgcggtccagggcgacaaactcgcgggcgacaccgtg
atctcctacggcgacctgctgttccgcagctatatcctgcgcgacctcgtggagagcgaa
gcggcgttcagcgtggtggtggattcgtcgctgaccgacgcggaaaacgccagcgtgcgc
gattttgcatggtgctcggcggccgacgaccgcggcctgttcggcaacaaggtcacgctg
cgtcatgtgtcgagcgggcaggaggcttcgtccgcgatcgcctcgcaaacgccgcacggc
cgttgggtggggttgttgaacgtgcgcggcgaagggcgcgagcgtttgcaagcggtgctc
ggccagttgcaggcgcgtccggatttcgattcgctcgacatgcccgcgctgctgaacgcg
ctgatcgaagccggtgaatcgatcgaagtgcaatacgtgcacggccactggcgcggtgtg
aacgacctggaagacttccgtcgcgccggcgatttcgcgcatgcgcaagcgccgttcgcg
gcaacggcgggcaacaaggccgcggacgcaaccggcggagccgcgcaatga

DBGET integrated database retrieval system