KEGG   Photorhabdus thracensis: VY86_01330Help
Entry
VY86_01330        CDS       T03944                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ptt  Photorhabdus thracensis
Pathway
ptt00550  Peptidoglycan biosynthesis
ptt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VY86_01330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ptt01002]
    VY86_01330
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ptt01011]
    VY86_01330
Enzymes [BR:ptt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VY86_01330
Peptidases [BR:ptt01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   VY86_01330
Peptidoglycan biosynthesis and degradation proteins [BR:ptt01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   VY86_01330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase FAA_hydrolase
Motif
Other DBs
NCBI-ProteinID: AKH62201
UniProt: A0A0F7LJZ2
LinkDB All DBs
Position
404390..405601
Genome map
AA seq 403 aa AA seqDB search
MKYTTTSRFIKSATLGIALAISASAFADGNDVNLKTMIPGVPQIDAEAYILIDYNSGKVL
AEMNADAHRDPASLTKMMTSYVIGQTIKSGKIGPNDMVTVGTDAWATGNPVFKGSSLMFL
KPGDQVSVSMLSRGINLQSGNDACVAMADYVAGSQESFVNLMNGYVKSLGLQNTHFKTVH
GLDAEGQYSSARDMALIGQALIRDVPEEYAIYKEKEFTYNNIRQTNRNGLLWDKSLNVDG
IKTGHTNAAGYNLVASATEGDMRLISAVLGGHTYKGRETESKKLLTWGFRFFETVAPLKA
GKEFASEPVWFGDNDRVQLGVDKDVYLTIPRGRLKDLKASYVMNNTELHAPLAKSQVVGT
INFQLDGKTVEQRPLVIMNEVKEGSIFSRFIDYIKLLFHHWFG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatacaaccacttctcgttttataaaaagtgccaccctaggtattgcgctggca
ataagtgcttctgcctttgccgatgggaatgatgtaaacctgaaaacgatgatcccaggt
gtgcctcagattgatgctgaagcttatattcttatcgactataactcaggcaaagttctg
gctgagatgaacgcggacgcacaccgtgatcctgccagtttgacaaaaatgatgaccagt
tacgttattggtcagacaatcaaatcaggcaaaatcggcccaaatgatatggtcactgtt
ggcactgatgcatgggcaacaggtaatccggtatttaaaggctcctccctgatgttcctc
aaaccaggagatcaggtctcagtttctatgttatctcgcggtataaacctgcaatccggt
aatgatgcctgtgttgcaatggcggattatgttgccggcagccaagagtctttcgttaat
ctaatgaacggctatgtaaaatcccttggcttacagaatacacatttcaaaactgttcat
ggtctggatgcggaaggccaatacagctctgcccgtgatatggcattgattggtcaggcc
cttatccgcgatgttcctgaagaatatgctatctataaagagaaagaatttacctacaat
aatatccgtcaaacaaaccgaaacggcttattgtgggataaaagcctgaatgtagatggt
ataaaaaccggccacacgaatgccgcaggctataatctggtcgcttctgcaacggaaggc
gatatgcgtctgatttctgcggtattaggcggccatacttataagggccgtgaaacagaa
agcaagaaactgctgacttgggggttccgtttctttgaaaccgtcgcgccactgaaagcc
ggcaaagaattcgcttctgaaccggtttggttcggagacaacgatagggttcaactaggc
gttgataaagatgtttatctaactattccccgtggccgtctgaaagatttgaaagccagc
tatgtcatgaataatactgaattacatgcaccgttagcgaaaagtcaggtcgtcggtacc
atcaattttcaacttgatggcaagactgttgaacaacgcccattagtcatcatgaatgaa
gtgaaagaaggcagcatcttcagccgttttatcgattacatcaaactgctatttcatcat
tggtttggctaa

DBGET integrated database retrieval system