KEGG   Photorhabdus thracensis: VY86_02645Help
Entry
VY86_02645        CDS       T03944                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
ptt  Photorhabdus thracensis
Pathway
ptt00030  Pentose phosphate pathway
ptt01100  Metabolic pathways
ptt01110  Biosynthesis of secondary metabolites
ptt01120  Microbial metabolism in diverse environments
ptt01130  Biosynthesis of antibiotics
ptt01200  Carbon metabolism
ptt01230  Biosynthesis of amino acids
Module
ptt_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ptt_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ptt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VY86_02645
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    VY86_02645
Enzymes [BR:ptt01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     VY86_02645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C E1_dh
Motif
Other DBs
NCBI-ProteinID: AKH62398
UniProt: A0A0F7LJX9
LinkDB All DBs
Position
658176..660170
Genome map
AA seq 664 aa AA seqDB search
MTTRKTLANAIRFLSMDAVQKAKSGHPGAPMGMADIAEVLWRDYLNHNPTDPHWVDRDRF
VLSNGHGSMLIYSLLHLTGYDVSIDDLKNFRQLHSKTPGHPEYGYAPGVETTTGPLGQGI
ANAVGFAIAERTLAMQFNRLGHDIVDHNTYVFMGDGCMMEGISHEVCSLAGTLKLGKLIA
FYDDNGISIDGHVEGWFTDDTAGRFEAYGWHVVRGVDGHNADAVKAAIEEARKVSDKPSL
LMCKTVIGFGAPTKAGTHDSHGAPLGDAEIAATREVLGWHHPAFEIPAEIYSEWDAKEMG
NAKQATWNKKFAAYEKAHPELAAEFKRRTHGELPANWETESKAFIEQLQQNPANIASRKA
SQNALEAFGKVLPEFMGGSADLAPSNLTMWSGSKPLNEDQAGNYIHYGVREFGMSAIMNG
IALHGGFVPYGATFLMFVEYARNAVRMAALMKIRSIFVYTHDSIGLGEDGPTHQPVEQIA
SLRVTPNLSTWRPCDQVESAVAWKYAIERKTGPSALIFSRQNLAQQERTAEQLVNIEKGA
YILKDCEGQPELILIATGSEVELAVGAYNQLTQEGRKVRVVSMPSTDAFDKQDAAYREAV
LPTAVSARVAVEAGIADYWFKYVGMYGAIVGMATFGESAPADQLFKEFGFTVENVVAKAK
ALLK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcgtaaaacccttgctaatgctattcgcttccttagcatggatgctgtgcag
aaagcaaaatcagggcaccctggtgcgcctatgggaatggctgatatcgctgaagtttta
tggcgtgattatttaaatcataaccccactgatccacattgggttgatcgtgatcgtttt
gtattgtctaacggccatggctctatgctgatttatagcctgttgcatctcaccggctat
gacgtttctattgatgatctgaaaaacttccgtcagttacattccaaaacgccaggccat
cctgagtatggttatgcgccaggcgtagagacaacgaccggtcctttggggcaggggatt
gccaatgcagtaggttttgctattgctgaacgtactctggctatgcaatttaaccgtctt
ggtcatgatattgttgaccataacacttatgtgtttatgggagacggttgcatgatggaa
ggcatttctcatgaagtttgctctctggcgggaacgttaaaactgggcaaactgattgct
ttctatgatgacaatggtatttctattgatggtcatgttgaaggctggtttaccgatgat
accgcaggtcgttttgaggcctatggctggcatgtcgttcgcggcgttgatggtcataat
gcagatgcagtcaaagcagcgattgaagaagcacgtaaagtttctgataaaccttcactg
ctgatgtgtaaaacagttatcggttttggcgcgccaaccaaagcgggtactcatgattct
cacggtgccccactgggtgacgcagaaattgccgcaacgcgtgaagtgctgggttggcat
catccagcatttgaaattccagcggaaatctattctgagtgggatgcaaaagagatgggt
aacgcgaagcaagcaacctggaataagaaattcgctgcttatgaaaaagcgcatcctgaa
ttagccgctgaattcaaacgccgtacccatggcgaattaccggcaaactgggaaaccgaa
tcaaaagcatttatcgaacaattgcaacaaaatcctgccaatattgccagccgtaaagcc
tctcagaatgctttggaggctttcggtaaagtgctgcctgaatttatgggggggtctgct
gacttggcgccaagtaatctgacgatgtggtcaggttctaagccattgaacgaagatcag
gcaggtaactacatccattatggcgttcgtgaatttggtatgtccgccattatgaacggt
attgctctgcatggcggttttgtaccttatggtgcaactttcctgatgttcgttgaatat
gcccgtaacgcagtgcgtatggcggcactgatgaaaattcgcagcatctttgtttatacc
catgactcaatcggtttgggtgaagatggcccgacccaccagccggtagaacagatcgcc
agtttgcgtgtgacgccaaatctaagcacatggcgtccatgtgaccaggttgaatctgcg
gttgcatggaaatacgctattgaacgtaaaacaggcccatcagcacttattttctctcgt
cagaatctggcacagcaagaacgtactgctgaacagttggttaatattgagaaaggtgct
tacatcctgaaagattgtgaaggtcagccagagttgattctgatcgcaacaggttcagaa
gtggaattggcagtaggggcttataatcaattgactcaggaaggccgtaaagtacgtgta
gtttctatgccgtctactgatgcttttgataagcaggatgctgcgtaccgtgaagcggta
ttgccaactgcggtttctgcgcgtgttgcagttgaagcgggtattgctgattactggttt
aaatatgtcggtatgtatggcgctatcgtgggtatggcgacatttggtgaatcggctcct
gctgatcagctgtttaaagagttcggtttcactgtagagaatgttgtcgctaaggctaaa
gctctgctgaaataa

DBGET integrated database retrieval system