KEGG   Photorhabdus temperata: VY86_08870Help
Entry
VY86_08870        CDS       T03944                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ptt  Photorhabdus temperata
Pathway
ptt00564  Glycerophospholipid metabolism
ptt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ptt00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VY86_08870 (glpD)
Enzymes [BR:ptt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     VY86_08870 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 FAD_binding_3 NAD_binding_8 3HCDH_N FAD_oxidored HI0933_like GIDA Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AKH63436
UniProt: A0A0F7LNM3
LinkDB All DBs
Position
complement(2086072..2087574)
Genome map
AA seq 500 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLAKATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLNLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDNLGKRVSLPSS
KGLKFGAHSVLKPELVRGFEYSDCWVDDARLVVLNAQEVKKHGGEVRTRTKVTRAWREQD
GWMVEAEDLRTGKTHTWRAKGLVNATGPWVKEFFDDGLKLKSPYGIRLIKGSHIVVPRVH
DEPQAYILQNEDNRIVFVIPWMDEFSIIGTTDVEYNGDPKEVKIDDQEINYLLEVYNNHF
KKQISREDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDEQGKAPLLSIFGGKLTTYRK
LAEHAMEKMIQYYPNAGAAWSKNGQLPGGNLEGCDRDGYARLLRKRHNWLPEGVAVRYAR
TYGSNSGLILQGANNLADLGKSFGQGLYEAELRYLVNNEWVVELDDAIWRRTKLGMWLNE
EQKQRIAVWLAENAKLHTEI
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaaactaaagacttgattgtgatcggtggcgggatcaacggcgccggtattgcggca
gatgccgctggccggggactctctgttctgctgctggaagcgcaagacttagccaaagcc
acttcatccgccagttcaaaactgatccacggtggcctgcgctatctggaacattatgaa
ttccgtctggtcagcgaagcgctggcagaacgcgaagttttattaaatctcgcaccacac
atcgctttccctatgcgttttcgtctgccgcaccagccgcacctgcgcccggcatggatg
atccgcattggtctgttcctttatgacaatttaggcaaacgcgtcagcctgccgagcagt
aaagggctaaaattcggtgctcattccgttctgaaaccagaattagtccgcggctttgaa
tattctgactgctgggttgatgacgctcgtttagttgtccttaacgctcaggaagtcaaa
aaacacggtggagaagtccgtacccgaacaaaagttacccgtgcatggcgtgaacaagat
ggctggatggttgaagccgaagatctgcggacaggtaaaacccatacctggcgtgcaaaa
ggtctggttaacgccaccggtccttgggttaaagaattctttgacgatggcctgaaactg
aaatcaccttatgggattcgcctgatcaaaggcagccatattgtggtgccaagagtgcat
gatgagccgcaggcttatattctgcaaaacgaagataatcgtattgtatttgtgattccc
tggatggatgaattctccattatcggaacaaccgatgtggaatataacggcgatccaaaa
gaggtgaagatcgacgatcaagagataaactatctattggaagtctataacaatcacttt
aagaagcaaattagccgtgaagatatcgtctggacctattccggtgtacgtccactgtgt
gatgacgaatctgattcacctcaggcgattacccgtgactacacactcgatattcatgat
gagcagggcaaagcgccattgctgtctatattcggtggtaaattgaccacttaccgtaag
ctggcagaacacgcaatggagaaaatgattcaatactatccaaatgccggagcagcctgg
agcaaaaatggtcaattaccgggcggtaatctggaaggctgcgaccgtgacggttacgcc
cgcttactgcgtaaacgccacaactggctgccggaaggcgttgccgtgcgctatgcgcgt
acttacggcagcaacagtggactgattctacaaggtgctaacaatctggcggatctcggt
aaatccttcggccaaggtctgtatgaagctgaacttcgttatctggttaacaatgagtgg
gttgttgaactggatgatgcgatctggcgccgtaccaaattgggtatgtggctgaatgaa
gagcagaaacagcgcattgcagtatggttagcagagaacgcgaagctacacaccgagatt
tga

DBGET integrated database retrieval system