KEGG   Photorhabdus thracensis: VY86_09420Help
Entry
VY86_09420        CDS       T03944                                 

Definition
(GenBank) DNA-3-methyladenine glycosidase
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
ptt  Photorhabdus thracensis
Pathway
ptt03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ptt00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    VY86_09420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ptt03400]
    VY86_09420
Enzymes [BR:ptt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     VY86_09420
DNA repair and recombination proteins [BR:ptt03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     VY86_09420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenine_glyco Alpha_L_fucos
Motif
Other DBs
NCBI-ProteinID: AKH63527
UniProt: A0A0F7LP06
LinkDB All DBs
Position
complement(2199038..2199595)
Genome map
AA seq 185 aa AA seqDB search
MELTRCNWVTSDPEYLSYHDNEWGKPQKDSQKLFEMICLEGQQSGLSWLTILKKREGYRQ
CFHQFDPVKIAVMDENDVVRLMFNPAIVRNRAKINAIINNARAYLKMQQQGEEFSAFIWR
FVDNKPIINQWKTITEVPVKTDLSDELSQALKKRGFKFIGSTTCYAFMQATGLVNDHITD
CLCRK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggaattaacacgctgtaattgggtgacctctgatcctgaatatctgtcttaccatgat
aatgaatggggaaaaccacaaaaagatagccagaagctgtttgaaatgatctgtctggaa
ggccagcaatctgggctgtcatggctgactatcctgaaaaaacgcgaaggctatcgccaa
tgttttcatcagtttgatccggtaaaaattgccgtcatggatgaaaatgatgtggtacgg
ttgatgtttaatcccgctattgtccgcaatcgcgccaaaattaacgccattatcaataac
gcgcgagcatatcttaaaatgcaacaacagggtgaggaattcagcgcctttatctggcgt
tttgttgataacaaaccgattattaatcagtggaaaaccatcacagaggtgccggtaaaa
acagatctttcagatgagttatcacaagcactgaaaaaaagagggttcaaatttatcggc
agtaccacttgctatgcatttatgcaggcaacaggcttagtcaatgaccatataactgac
tgtttatgtagaaaataa

DBGET integrated database retrieval system