KEGG   Photorhabdus thracensis: VY86_14540Help
Entry
VY86_14540        CDS       T03944                                 

Definition
(GenBank) ribose 5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
ptt  Photorhabdus thracensis
Pathway
ptt00030  Pentose phosphate pathway
ptt01100  Metabolic pathways
ptt01110  Biosynthesis of secondary metabolites
ptt01120  Microbial metabolism in diverse environments
ptt01130  Biosynthesis of antibiotics
ptt01200  Carbon metabolism
ptt01230  Biosynthesis of amino acids
Module
ptt_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ptt_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ptt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VY86_14540
Enzymes [BR:ptt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     VY86_14540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC RNase_PH_C BON
Motif
Other DBs
NCBI-ProteinID: AKH64355
UniProt: A0A0F7LP40
LinkDB All DBs
Position
complement(3378743..3379402)
Genome map
AA seq 219 aa AA seqDB search
MTQDELKKAVGWAALEFVTPGTIVGVGTGSTASHFIDALGSIKDQIEGAVSSSEASTEKL
KSLGIPVFDCNEVDSLDIYVDGADEINGNMQMIKGGGAALTREKIISAIAKKFICIVDSS
KKVDVLGKFPLPVEVIPMARSYVARELVKLGGLPEYRLNVVTDNGNVILDVHNLAIIDPV
ELENKINRIAGVVTVGLFANRGADVVLMGTLDGVKTITQ
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggacgaactgaaaaaagcagtaggttgggcagcgctcgaatttgtcactccc
ggaacgattgtcggtgtggggacgggttcaacggcttcgcattttattgatgcccttggc
tcaattaaagaccaaattgagggggctgtatccagctctgaggcttctaccgaaaagtta
aaaagcctgggaattcctgtattcgactgtaatgaagtggattctcttgatatttatgtt
gatggcgcggatgaaatcaatggcaatatgcagatgattaaaggcggtggtgccgcattg
actcgcgaaaaaattatttctgcaatagcgaagaaattcatttgtatcgttgattcttct
aagaaagttgatgtattgggtaaattccctttaccagttgaagtgatccccatggcccgt
tcatatgttgcccgtgaattggttaaattgggtggtttaccagaatatcgcctgaacgtt
gtgactgataacggcaatgtgatcctggatgtgcataatttagcaattatcgatcctgtt
gagttagagaataaaattaatcgtatcgccggtgtagtcactgtcggtctgtttgctaat
cggggtgcggatgttgtattgatgggaacattagatggagtgaaaaccattactcaataa

DBGET integrated database retrieval system