KEGG   Photorhabdus temperata: VY86_17315Help
Entry
VY86_17315        CDS       T03944                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ptt  Photorhabdus temperata
Pathway
ptt00020  Citrate cycle (TCA cycle)
ptt00480  Glutathione metabolism
ptt01100  Metabolic pathways
ptt01110  Biosynthesis of secondary metabolites
ptt01120  Microbial metabolism in diverse environments
ptt01130  Biosynthesis of antibiotics
ptt01200  Carbon metabolism
ptt01210  2-Oxocarboxylic acid metabolism
ptt01230  Biosynthesis of amino acids
Module
ptt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ptt_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ptt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VY86_17315
  Metabolism of other amino acids
   00480 Glutathione metabolism
    VY86_17315
Enzymes [BR:ptt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     VY86_17315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AKH64833
UniProt: A0A0F7LSD9
LinkDB All DBs
Position
4003922..4005175
Genome map
AA seq 417 aa AA seqDB search
MESKVVIPAEGKKITVDAKGKLVVPNNPVIPYIEGDGIGVDVTPAMLKVVDAAVQKAYKG
ERKISWMEIYTGEKSTHVYGKDVWLPDETLDLIREYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPIRYYQGTPSPVKQPELTDMVIFRENAEDIYAGIEWKAGSAEADKVIKFL
QDEMGVNKIRFPQQCGIGVKPCSEEGTKRLVRAAIEYAIDNDRESVTLVHKGNIMKFTEG
AFKDWGYQLAREEFGGELLDGGPWVKIKSPKNGKEIIVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSVILS
AEMMLRHMGWTEAADLIIKGMEGAIAAKTVTYDFERLMEDAKLLKCSEFGDAIIQHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttattccggcggaaggtaaaaaaataacagtcgacgctaaaggt
aaactggttgttccgaataacccggtcatcccttatatcgaaggggatgggattggtgtc
gatgttacccctgcaatgttgaaagttgtcgatgcagcggttcagaaagcctataagggt
gagcgtaaaatttcctggatggaaatctacaccggtgaaaaatctactcatgtatacggt
aaagatgtttggttgccggatgaaactctggatctgatccgtgaataccgcgtcgccatc
aaaggccctctgacgacgccggttggtgggggtattcgttccctgaacgtggcattgcgt
cagcaattagatctgtatgtctgtcttcgccctattcgttactaccagggaacgccaagc
ccggttaaacaacctgagctgactgatatggtcatcttccgtgaaaacgcggaagatatt
tacgccggtatcgaatggaaagcgggctccgcggaagcggataaagtgatcaaattcctg
caagacgaaatgggcgtgaataaaatccgtttcccacagcaatgtggtatcggcgtgaaa
ccctgttctgaagaaggcactaaacgcctggttcgtgctgctattgaatacgcgattgat
aatgaccgtgaatcagttactctggttcacaaaggcaacattatgaagttcaccgaaggg
gctttcaaagactggggttaccagcttgctcgtgaagagttcggcggtgaactgctggat
ggcggtccttgggtgaaaattaagagcccgaaaaacggcaaagagatcattgtcaaagat
gtgattgctgatgctttcctgcaacagattctgctgcgtccggctgaatatgacgttatc
gcctgtatgaacctgaatggcgactatatttctgatgcactggctgctcaggttggtggt
atcggtatcgctccgggagcaaatatcggggatgaatgcgctctgtttgaggcaactcat
ggtacagcacctaaatatgcgggccaggataaggtgaacccaggttcagttattctttcc
gctgagatgatgttgcgtcatatggggtggacagaagccgctgatcttatcattaaaggc
atggaaggcgcgattgctgcgaagaccgtcacttacgatttcgagcgtttgatggaagac
gcgaagctgttgaaatgcagtgaatttggtgacgctattatccagcatatgtaa

DBGET integrated database retrieval system