KEGG   Pseudoalteromonas tunicata: PTUN_a0440Help
Entry
PTUN_a0440        CDS       T05187                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ptu  Pseudoalteromonas tunicata
Brite
KEGG Orthology (KO) [BR:ptu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PTUN_a0440 (ahpF)
Enzymes [BR:ptu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PTUN_a0440 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO Thi4 NAD_binding_8 FAD_binding_3 K_oxygenase AlaDh_PNT_C Glutaredoxin NAD_binding_9 Lycopene_cycl FMO-like Shikimate_DH YojJ
Motif
Other DBs
NCBI-ProteinID: ATC93232
LinkDB All DBs
Position
I:complement(419987..421552)
Genome map
AA seq 521 aa AA seqDB search
MLDAKIKTQLQAHLNNITKPIQLVINLDESKKSIELQSLANELSELNSLVSVSTTQNTAI
RAPQLSVLGEQSEINFAGVPMGHEFTSLILALLHTGGHATKASAEEIEQISTLTAPLNFE
IYISLSCQTCPAVVQALNLMAAINPAIKTTMIDGALFQNEVQQRNILSVPAVYLNGQPFS
HGAISLADILAKLDKNHAGKVAKQLNEKEQYDVLIVGGGPAGAAAAVYAARKGLRTGLVA
ERFGGQVSDTLGIENFLSVKSTQGPQLVAQLEEHVKEYDVDLITAQKAKQLNTENGFAIE
LESGAQLQAKSVILATGARWREMNVPGEQQYRGKGVAYCPHCDGPLFKNKKVAVIGGGNS
GIEAAIDLANIVEHVTVLEFAQSLRADAVLIKKARSMGNITIITQAQTTEVVGDGNKVIG
LNYRDHANNEEHHLALAGIFVQIGLLPNTDWLKGTVELSQRGEIITNSHGATSIAGVFAA
GDVTNTPYKQIIIAIGSGATASLGAFDYLIRHDQAQTEFAA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgcaaaaatcaaaacgcagttacaagcccatttaaacaacatcacaaaacct
attcaattggttatcaatcttgacgagagtaaaaaatcaattgaattacaatcacttgca
aatgaattatctgagctaaactcacttgtaagtgtaagtaccactcaaaacacagcaatt
cgcgcaccgcagttgagcgtgcttggtgaacaaagcgagattaattttgctggtgtcccg
atgggccatgaatttaccagtttaatactggcgttattacataccggcggccatgcaaca
aaagcatctgccgaagaaattgagcaaattagtactttaacagcgcctcttaatttcgaa
atttatatttctttgagttgccaaacctgtccagcggttgtgcaagcactcaatttaatg
gcggcaataaacccggcaattaaaaccactatgattgatggcgctttatttcaaaacgaa
gtgcaacaacgtaatattttgtctgtaccagctgtttatttaaatgggcaaccctttagt
catggcgcaattagtcttgccgatattttagctaaactcgataaaaatcatgcgggtaaa
gtagccaagcagctcaatgaaaaagaacaatacgatgtactcattgtgggtggtggccca
gcaggtgcagcggcggctgtttatgcggcgcgaaaaggtttacgaactggcttagttgcc
gaacgctttggcgggcaagtgagtgatactcttggtattgagaactttttatcggttaaa
tcaactcagggcccacaattagttgcccagcttgaggaacacgtcaaagaatatgatgtg
gatttaatcactgcacaaaaagccaaacagttgaatactgaaaatggctttgcgattgaa
ttagaaagcggtgcacaattacaagcaaaatcggtgattttagcgacaggtgctagatgg
cgtgaaatgaacgtgccaggtgagcaacaatatcgtggtaaaggtgttgcgtattgcccg
cattgtgatggtccattattcaaaaacaaaaaagtagcggttatcggtggtggtaactct
ggaatagaagctgcaatcgacttagccaatattgttgagcacgttacagtattagaattt
gcacaaagcttacgtgctgatgccgtattaattaaaaaagcgcgcagcatgggcaatatt
actattattacccaagcacagaccactgaagtggtcggtgatggcaataaagtgattgga
ctcaactaccgtgatcatgccaacaatgaggaacatcatttggcgctagcaggtattttt
gtgcaaattggcttattacccaatacagattggctcaaaggtacagtcgagctttcacag
cgaggtgagattatcaccaacagccatggcgcaacatcaattgccggtgtatttgccgca
ggtgatgtcaccaatacaccttataagcaaatcattattgctattggaagtggcgcgacc
gcaagtttaggcgcgtttgattatttaatacgccacgatcaagcacaaaccgaattcgca
gcgtga

DBGET integrated database retrieval system