KEGG   Pseudoalteromonas tunicata: PTUN_a0574Help
Entry
PTUN_a0574        CDS       T05187                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ptu  Pseudoalteromonas tunicata
Pathway
ptu00473  D-Alanine metabolism
ptu00550  Peptidoglycan biosynthesis
ptu01100  Metabolic pathways
ptu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ptu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PTUN_a0574 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PTUN_a0574 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PTUN_a0574 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ptu01011]
    PTUN_a0574 (ddl)
Enzymes [BR:ptu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PTUN_a0574 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ptu01011]
 Precursor biosynthesis
  Amino acid ligase
   PTUN_a0574 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: ATC93349
LinkDB All DBs
Position
I:542086..543000
Genome map
AA seq 304 aa AA seqDB search
MNPQQFGKVAVLMGGSSAERDVSLRSGQAVLNALISQGVDAFAFDPAERNLFDLKSLQTD
RAFIALHGRGGEDGTIQGALEFLGLPYTGSGVLGSALAMDKVRCKELFKARGLSSAEFVV
VEQGAQFDSQAIINEFGAVMVKPAHEGSSIGMAKAATASELNEAISNAFRFDDTVMLEKW
ITGREFTVTMISGVAQPIVEMVTPRGFYDYEAKYQANSTQYYCPAELSQSETENLQLLAQ
HAFKLVGASGWGRVDAMRDQAGQFYLLEVNTVPGMTEKSLVPMAAKANGMNFSQLVINIL
EQTL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatccacaacaatttggcaaagtagcagtactaatgggtggtagttcagcagaacgc
gatgtctcattacgttcgggccaagctgtattaaatgctttgatatcgcaaggtgttgat
gcatttgcttttgatcctgcagagcgcaatttattcgatcttaagagtttacaaaccgac
agggcctttattgctttgcatggccgtggtggtgaagatggcaccattcaaggtgcactt
gagtttttaggtttaccttacaccggtagtggtgttttaggttcagcattagcaatggat
aaagtacgttgcaaagagctatttaaagcccgcggtttaagctcggctgagtttgttgta
gttgagcaaggtgcgcagtttgatagccaagccattattaacgaatttggcgctgtaatg
gtaaagccagctcatgaaggatcaagcattggtatggcaaaggcagcaaccgccagtgaa
ttaaatgaagccatcagtaatgcgtttcgttttgatgacactgtgatgcttgaaaagtgg
attaccgggcgcgaatttaccgtcactatgatttcaggagtcgcacaaccgattgttgaa
atggtgacgccgcgtggtttttatgattatgaagcaaaatatcaagcgaacagtacacaa
tattattgccccgcagagctgagccaatcagaaacggaaaatttacagctgttagcacag
cacgcatttaagttagttggtgccagtggttggggtcgagttgatgcaatgcgcgatcag
gcagggcaattttacctgcttgaggtaaatacggtgccaggcatgacagagaaatcgtta
gtacctatggcagcaaaggcaaatggtatgaatttcagtcaattagttataaatatattg
gagcaaacgctttaa

DBGET integrated database retrieval system