KEGG   Pseudoalteromonas tunicata: PTUN_a1759Help
Entry
PTUN_a1759        CDS       T05187                                 

Definition
(GenBank) peptidyl-dipeptidase A
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ptu  Pseudoalteromonas tunicata
Brite
KEGG Orthology (KO) [BR:ptu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ptu01002]
    PTUN_a1759
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptu04147]
    PTUN_a1759
   04090 CD Molecules [BR:ptu04090]
    PTUN_a1759
Enzymes [BR:ptu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     PTUN_a1759
Peptidases [BR:ptu01002]
 Metallo Peptidases
  Family M2
   PTUN_a1759
Exosome [BR:ptu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PTUN_a1759
CD molecules [BR:ptu04090]
 Proteins
  PTUN_a1759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ATC94344
LinkDB All DBs
Position
I:complement(1617575..1619416)
Genome map
AA seq 613 aa AA seqDB search
MTTKTFKLSLTALVVGASLSLTACNDANKSNAIPVVAQAVTAQDAKQFLAKSEQELQALY
LESNRAEWIYANFITEDTSELSAAVNEKMTAAVVRLANEAAKFNALELDSDTRRKLDKLK
QALTLAAPQDEAKNAELSKLMAELGGLYGKGKYCKTEGECLSLGDMTAKMATSRDYDELL
DLWQGWRQVSKPMRPLYEQQVTLANEGAKELGYADTGAMWRSKYDMPADDFAKELDRIWG
QVKPLYNSLHCHVRAKLGEKYGTDKVPQDQPIPAHLLGNMWAQTWGNVYDLVAPADADPG
YDVTELLAKHNYDELTMVKGAEKFFTSMGFDPLPETFYERSLFTKPQDRDVQCHASAWNL
DSKDDLRIKMCIQRTGEEFSVIHHELGHNFYQRAYNKLPLYYQESANDGFHEAIGDTIAL
SVTPGYLKEIGLLDQVPDESKDIGLLMKMAMDKVAFIPFGLLVDQWRWQVFSGQVTPENY
NQAWWDLREKYQGVKAPIARSEADFDPGAKYHVPGNTPYTRYFLAHILQFEFHKSLCEIA
GNKEAIHRCSVYNSKEAGERLNAMLEMGSSRPWQEALASVTGKPEMDATAILDYFAPLQK
YLDEQNKGRQCGW
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaaaacctttaagctaagcttaacggcactggtagtaggtgcaagtttatcg
cttacagcctgcaatgatgcaaataaaagcaacgccatacctgtcgttgcacaagctgtg
acagctcaagatgctaaacaatttttagccaaatcagagcaagaactgcaagcactatat
ttagaaagtaatcgagctgaatggatttatgctaattttattaccgaagatacctctgag
ttatcagccgctgtaaatgaaaaaatgactgctgccgtggtccgtttagcgaatgaagca
gccaaatttaatgcgcttgagctcgatagtgatactcgtcgtaaacttgataaactaaaa
caagcgctcacgcttgcagcaccgcaagatgaagctaaaaatgctgaactttcaaaatta
atggctgagctcggtggtttatacggtaaaggtaaatactgtaaaactgaaggtgaatgt
ttaagcttaggcgacatgacagccaaaatggctaccagccgtgattacgatgaattactc
gatttatggcaaggttggcgtcaggtttcaaaacctatgcgtccactgtatgaacaacaa
gtgacgcttgcaaacgaaggtgctaaagagcttggctacgcagacaccggcgcaatgtgg
cgtagcaaatacgacatgcctgctgatgattttgccaaagagctagaccgtatttggggc
caagttaaaccgctttataattctttacattgtcatgttcgtgctaaattgggcgaaaaa
tatggcacagataaagtacctcaagatcagccaatcccagcacatcttcttggtaacatg
tgggcacaaacttggggcaatgtttatgatttagtggcacctgcagatgcggatccgggt
tacgatgtcacagaacttttagccaaacataactatgatgaactcactatggttaaaggc
gcagaaaagttctttacctcgatgggttttgaccccctgccagaaaccttctatgagcgc
tctctttttactaaaccacaagatcgcgatgtacaatgccatgcgtctgcgtggaattta
gacagcaaagacgatttacgtattaaaatgtgtattcaacgcactggtgaagaattctcg
gtcatccaccatgagttagggcataacttctatcaacgtgcttacaacaaattgccactt
tattatcaagaaagtgccaatgatggtttccatgaagcgattggcgatacgattgctctt
tcggtcacacctggttatttaaaagaaattggtttactcgaccaagtacctgatgaatca
aaagacattggtttattaatgaaaatggcgatggataaggtagctttcattccatttggc
ttattagttgaccaatggcgctggcaagtattttcaggccaagtaactcctgaaaattac
aaccaagcgtggtgggatttacgtgaaaaataccaaggtgtaaaagcgccaattgcccgt
agtgaagcggactttgatccaggtgcaaaataccatgtaccaggtaatacgccttacacc
cgttacttcttagcacatattctacagtttgaattccataaaagcttatgtgaaattgca
ggcaataaagaagcaattcaccgttgttcggtttataactcaaaagaagcgggtgaacgt
cttaatgctatgctagaaatgggctcaagccgtccatggcaagaagcattagcttctgta
acaggcaagcctgaaatggatgcaactgcaattttagattactttgccccactacaaaaa
taccttgatgagcaaaacaaaggccgtcaatgtggttggtaa

DBGET integrated database retrieval system