KEGG   Pseudoalteromonas tunicata: PTUN_a1862Help
Entry
PTUN_a1862        CDS       T05187                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
ptu  Pseudoalteromonas tunicata
Pathway
ptu00500  Starch and sucrose metabolism
ptu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PTUN_a1862
Enzymes [BR:ptu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PTUN_a1862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ATC94431
UniProt: A0A346SS00
LinkDB All DBs
Position
I:1724561..1726984
Genome map
AA seq 807 aa AA seqDB search
MKVMSTLALSVLAASLMGCNKQPSQAEAPVVTVPIATGAPGVTPYWAYSGKTGIGTSFEQ
YLNGQYSDNAPTKAVSKVWFSIAQGLITETMFGLIHQAQIKDMQFVVKGADFIATERDDT
TDTIEYLSTDEQGRPQSLAYKITTLDKQGRFKIEKHVFTDPSDQSLFVRVVIESFSGPLT
AYVSANPYVNNNGVGDSAAVENGALVAWEGDNVITLKAASGFKHAMVGFTGISDGLTQLQ
ETDALNNLYQQTGSTPGNVSLFAELGSVAAKGAAPTQFDLVLSFGKSKESSLKSANATLK
RGYDATLSEYNGEGDFIGWQDYLASLKPLNNMTNQTTDNGKLLYTSALVLKAQEDKTHAG
AVIASLSNPWGDTVKAIEGSTGYKAVWVRDFYQVAMAFLALGDNETAKIAFEYLEKVQVS
ANTPGNGGDTGWFLQKTHVDGELEWVGVQLDQTAMPIMLAWKLWQAQQLSDSELINWYQK
MLKPAADFLVKGGRAKILWNDTHITPPMTQQERWEEQAGHSPSTTAAVIAGLITAADIAK
AAGDVQNSALYLATARGYSAHIEAQMVTTQGTLPGSDGHYYIRINQNEDANSDSKLGDNN
GRTGLDKKQILDGGFLELVRYGVRSADDSHVVASLNEYDDETLPENLRVKYSFKFAGQEG
SFAGWRRYGNDGYGEDETTGSNYAATGGNTPGQRGRVWPFFTGERGHYELARAKQVAGEK
ALSDETMSQLKLNYVKAMELFANEGMMLPEQVWDNVGVNPQGYTSGEGTNSATPLAWTHA
EYVKLIKSLTDQAVWDYYPIVAEQLKQ
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaatgtcaacgttagcactgtcggttttagcggcctcattaatgggttgcaat
aagcaaccaagtcaggctgaagcgccagttgtgacagtgcctatcgcgaccggtgcgcca
ggtgtgaccccttattgggcttattcaggtaaaactgggattggtacgtcttttgagcaa
tatcttaatggtcaatatagcgataatgctcccactaaagcggtatcaaaagtatggttt
agcatcgcacaaggccttatcaccgagaccatgtttggtttaattcaccaagcgcaaatt
aaagatatgcagtttgtagtcaaaggtgctgattttatcgcaacagagcgcgatgatacc
actgataccattgagtatttatcgaccgatgaacaaggacgtccacaatcgctggcctac
aaaattaccacgctggataaacaggggcgctttaaaattgaaaagcatgtttttaccgac
ccaagcgatcaaagcttgtttgtccgtgtggttattgagagcttttcaggcccattaacg
gcgtatgtctcggctaatccgtatgttaataacaatggcgtaggcgacagtgcggcggtt
gaaaacggcgcattagtggcatgggaaggcgataacgtaattacgcttaaagcggccagt
gggtttaaacacgccatggttggttttactgggatctctgatggtctgacacaattacaa
gagacagatgcgcttaataatctttatcaacaaacgggaagcacgcctggcaatgtcagc
ttatttgccgaacttggcagtgttgctgctaaaggcgcagctcccactcaatttgattta
gtactgagctttggtaaaagcaaagaatccagtttaaagagcgcaaatgctacgttaaaa
cgcggttatgacgccacgttgagtgaatacaatggcgaaggcgactttatcggttggcaa
gattatttagcgagccttaagccactgaataacatgacgaatcaaactactgataatggc
aagttgctctacaccagcgccttggtattaaaagcacaagaagataaaactcatgcaggt
gccgtgattgcatcattgtctaatccgtggggtgataccgtaaaagccattgaaggatca
acagggtataaagcggtttgggtacgcgatttttatcaagtcgctatggcgtttttagcc
ctgggtgataacgaaacggcaaaaattgcgtttgaatacctagaaaaagtacaagtatca
gccaataccccaggtaatggtggcgatacggggtggttcttacaaaaaacccatgttgat
ggtgagcttgaatgggttggggtacaacttgatcaaaccgcgatgccaattatgttggca
tggaaactatggcaagcgcagcagttaagcgatagcgaattaattaactggtatcaaaaa
atgcttaaacctgccgctgattttttagttaaaggcgggcgagctaaaattttatggaat
gatactcacattacaccgccgatgacgcaacaagagcgctgggaagaacaagcggggcac
tcgccttccactaccgctgcggttattgcaggccttattactgctgccgatattgcaaaa
gcggcgggtgatgtgcaaaacagtgcgctttatttagcaaccgctcgtggatactcagct
cacattgaagcgcaaatggtgaccacacaaggcacattaccgggcagtgatggtcattat
tatattcgcattaatcaaaacgaagatgccaactcagatagtaagcttggtgataataac
ggtcggacaggcctcgacaaaaaacaaattcttgatggcggcttcttagaattggtacgt
tatggcgtgcgaagtgctgatgatagtcatgttgttgccagcttaaatgaatacgacgat
gaaaccttacctgagaatttacgtgttaagtacagttttaaatttgcagggcaggagggc
agctttgccggttggcgtcgatatggtaacgacggttacggtgaagatgaaacgacaggc
agtaattatgctgcaacaggtgggaataccccaggtcaacgtggtcgagtttggccgttt
tttaccggtgagcgtggtcattatgagttagcgcgtgctaaacaagtcgcaggtgaaaaa
gccttgagtgatgaaaccatgtcacagttaaaactgaactacgttaaagcgatggagcta
tttgctaacgaaggcatgatgttgcccgagcaagtctgggacaatgtgggcgttaatccg
cagggctatacctcaggtgaaggcacaaattcagcgaccccccttgcttggacgcatgca
gaatacgttaaattaataaaatcactgaccgatcaagctgtatgggattattacccaatc
gtggctgagcaattaaaacaataa

DBGET integrated database retrieval system