KEGG   Pseudoalteromonas tunicata: PTUN_a2854Help
Entry
PTUN_a2854        CDS       T05187                                 

Definition
(GenBank) superoxide dismutase, Fe-Mn family
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ptu  Pseudoalteromonas tunicata
Brite
Enzymes [BR:ptu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PTUN_a2854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ATC95266
LinkDB All DBs
Position
I:2615879..2616460
Genome map
AA seq 193 aa AA seqDB search
MAFELPSLPYAIDALVPHISQETLEFHHGKHHNTYVVKLNGLIAGTDFENKSLEEIVRTS
EGGVFNNAAQIWNHTFYWHSLSPNGGGEPTGAVAAAIDAKWGSFAAFKEAFNDKAVNNFG
SSWTWLVQLADGSLDIVNTSNAATPLTQEGVTPLMTVDLWEHAYYIDYRNVRPEYLNGFW
ALVNWEFANANLA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaactaccgtctttaccttatgcaattgatgcacttgtaccacatatttca
caagaaactttagagtttcaccacggtaaacaccacaacacgtatgttgttaaattaaac
ggtttaatcgctggtactgattttgaaaacaaatctttagaagaaatcgttcgtacttct
gaaggcggtgtttttaataatgcagctcaaatctggaatcatactttctactggcacagt
ttatcaccaaatggtggtggcgagcctactggcgcagtagcagctgcaattgatgcaaaa
tggggctcattcgctgcatttaaagaagcatttaacgacaaagctgtaaacaactttggc
tcaagctggacatggttagtccaactagctgatggctctttagatatcgtcaatacatca
aatgctgcaacaccgcttacacaagaaggtgttacaccattaatgactgtagatttatgg
gaacatgcatattacatagattaccgtaatgtgcgtccagaatacctaaatggtttttgg
gcattagtaaactgggaatttgcaaacgcaaacctagcttaa

DBGET integrated database retrieval system