KEGG   Pseudoalteromonas tunicata: PTUN_a3631Help
Entry
PTUN_a3631        CDS       T05187                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ptu  Pseudoalteromonas tunicata
Pathway
ptu00250  Alanine, aspartate and glutamate metabolism
ptu00410  beta-Alanine metabolism
ptu00430  Taurine and hypotaurine metabolism
ptu00650  Butanoate metabolism
ptu01100  Metabolic pathways
ptu01110  Biosynthesis of secondary metabolites
ptu01120  Microbial metabolism in diverse environments
ptu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ptu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PTUN_a3631 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PTUN_a3631 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PTUN_a3631 (gadB)
   00430 Taurine and hypotaurine metabolism
    PTUN_a3631 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PTUN_a3631 (gadB)
Enzymes [BR:ptu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PTUN_a3631 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ATC95927
LinkDB All DBs
Position
I:complement(3346566..3348194)
Genome map
AA seq 542 aa AA seqDB search
METKRYAVASEESLMRIFTVPEAPGSTLARIEREISSNLAGFLNENIAAIEKPLHEIEKD
FQLAQIPEEPTFVSDHAQQIMEQLVAHSVHTAAPSFIGHMTSALPHFVLPLSKLMVGLNQ
NLVKIETSKAFTPLERQVLGMMHHLVYGQNEGFYQKWMHSAKNALGAFCSGGTVANISAL
WIARNRLLKADGDFNGIASDGLIAAMLHYGYKGLAVLVSERGHYSLGKAADVLGIGRKNF
VAIETDENNKVNVAAMRLKAQELAAKGIKVMAIVGVAGTTETGNIDPLNDMADLAQELNC
HFHIDAAWGGATLLSNNSRYLLAGVERADSITIDAHKQMYVPMGAGIVLFKDPEASNAIE
HHAEYILRKGSKDLGSHTLEGSRPGMAMLVHACLNVISRKGYEMLIDKSLKKARYFADLI
KADPDFELISEPELCLLTYRYVPAKIQALLKTADEETRMDIYIALNRFTASMQKRQRESG
RSFVSRTRLTPVQYQKLPTVVFRVVLANPLTSEDILQSILAEQKELAQTDPIFKKYLQKY
LD
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaaagcgttatgccgtcgcctcagaagaaagcttaatgcgtatttttaccgta
ccggaagcgcctggttctacattagcgagaattgagcgagaaatatcgagtaatttagca
ggctttctgaatgaaaatattgcggctatagaaaaaccattacatgaaattgaaaaagat
ttccaattagcacagatccctgaagaacctacatttgtttctgatcatgcgcagcagatc
atggaacaattagtcgcccattcagtgcatacggctgcgccaagctttattggtcatatg
acttcagcgctgcctcattttgttttgccgctatcaaaattaatggttgggcttaatcaa
aatttagtaaaaatcgaaacctcaaaagcatttacgccacttgagcgtcaagttttaggg
atgatgcatcatttggtatatggccaaaatgaaggtttttatcaaaagtggatgcacagt
gctaaaaatgcgcttggtgcattttgttcaggtgggactgttgcgaatatctcagcctta
tggattgcccgtaaccgtttattaaaagcggatggtgattttaatggaattgctagcgat
ggtttaatcgctgcaatgctgcattatggctacaaagggttggctgtgttggtgtctgaa
cgtggacattattcattaggaaaagccgctgatgtattaggtattggtcgtaaaaacttt
gttgccattgaaaccgatgaaaataacaaagtaaacgttgcggcaatgcggttaaaagcg
caagaactcgcagcaaaaggcatcaaagtgatggcgatagtgggagtggcgggtacaacc
gaaactggtaatatcgatccattaaatgacatggctgatttagcccaagaacttaattgt
cattttcatattgatgccgcttggggtggcgcaacgttattgtcgaataactcacgttac
ttattagcgggagtagagcgagctgactcaattaccattgatgcacataaacaaatgtat
gtgccaatgggggctggtatcgtgttatttaaagaccctgaagcctcaaatgcgatagaa
caccatgcggagtatattttacgtaaaggttctaaagatttaggtagccatacattggaa
ggcagtcgtcctggtatggcgatgttagtgcatgcttgtttaaatgtgattagccgtaaa
ggctatgaaatgctcattgataaaagtcttaaaaaagcgcgctattttgctgatttaatt
aaagctgatccggattttgaattaatttcagaacctgagttatgtttgcttacgtatcga
tatgtgccagcaaaaattcaagcgctgcttaaaacagccgatgaagaaacgcgaatggat
atttatattgccttgaatcgttttacagccagcatgcaaaaacgtcaacgtgaatctggc
cgctcgtttgtttctcgtacgcgattgacaccggtacagtaccaaaaattacccacagtg
gtatttagagtggtattagcaaacccgcttacatctgaggacattttgcagagtattttg
gctgagcaaaaagaattggcgcaaacagatcctatttttaaaaaatacttacagaaatat
ttagactga

DBGET integrated database retrieval system