KEGG   Pseudoalteromonas tunicata: PTUN_a4238
Entry
PTUN_a4238        CDS       T05187                                 

Definition
(GenBank) indoleacetate---lysine synthetase
  KO
K03397  indoleacetate---lysine synthetase [EC:6.3.2.20]
Organism
ptu  Pseudoalteromonas tunicata
Brite
KEGG Orthology (KO) [BR:ptu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PTUN_a4238
Enzymes [BR:ptu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.20  indoleacetate---lysine synthetase
     PTUN_a4238
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-ProteinID: ATC96435
LinkDB
Position
I:3938964..3940229
AA seq 421 aa
MTISIEKPVPAIAEKTVDIQHTPFDADKIQAIVDKLWALKSNNTEAAPKISSYDEFAALV
PTMNGSQYTELAQQAFKQHTEVPVLIGGSSGTTGPSKLILERTNTPGSRPSEDDIQLITE
LRMAGALNPGDVVVNLFMVGMYSLLHQGFNRILEACYCSVIPLGSLNTDHLHNQLTFMAN
AEVNVLVGTPGTLIQMANAVKDSGITLNIKRILFTGECMGEAKANVLKAIFPGVRIIGCY
GLSECGFVAVEQFNGKYQVRDYAYFLEKSAQGRLLVTSLNPNLPTPVVRYDTGDQFNFIS
LANKIFLDNLDRADNSFNFIGNLIKCSTITTLASEFLAQKDVLIEVALDTDEQGRDNLVI
TLLVDGLSLAQCQTFEAQLCQLEDFREALDKRAGTVSVVCAPPQAATLSERNKHRTIVDR
R
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgactatctcaatcgaaaaaccagtaccagcgatagctgaaaaaaccgtcgatatccaa
catacaccgtttgatgccgataaaattcaagcaattgtcgacaaactttgggctttaaaa
agcaacaatacagaagcggcacccaaaatcagttcatatgatgagtttgcagctctggtt
ccgaccatgaatggtagccaatatactgagctggcccaacaggcatttaagcaacataca
gaagtacctgtcttaattggcggttcaagtggcacaactgggccaagcaagctcattttg
gagcgcaccaatacacccggaagccgtccaagtgaagatgacattcaacttattactgag
ctgcgcatggcgggcgcgcttaatcctggcgatgtagtggtcaacctttttatggttggc
atgtattctttgctacaccaagggtttaaccgaattttagaagcatgttattgctcagtg
atccctcttggctcgctcaataccgatcatctccataatcaactgacatttatggcaaac
gcagaggtgaatgtattagttggcactcctggcactttgattcaaatggctaatgcagtc
aaagacagtggtatcaccttaaatattaaacgcattttatttactggcgagtgcatgggt
gaagcaaaagcgaatgtattaaaagctatttttccaggtgtgcgcattattggctgttac
ggtttatctgaatgtggttttgtcgcggtagagcaatttaacggaaaataccaagtacgt
gattatgcttacttccttgaaaaaagcgcacaaggtcgtctgttagttactagcttaaat
ccaaacttgccaacacctgttgtacgctatgacactggtgatcaatttaactttatctca
ttggctaataagatttttttagacaatttagatagagctgataacagctttaacttcatt
ggtaatttaattaaatgcagcaccatcaccacacttgcgagtgagtttttagcgcaaaaa
gacgttttaattgaagttgctctcgataccgatgagcaagggcgggataacttggtgatc
accttgttagttgatggcctcagcctggcacaatgccaaacctttgaagcacagctatgc
caattagaagactttcgcgaagcgcttgataaacgcgcaggtactgtctctgtcgtttgt
gcgccaccacaagcagccacactatcagaacgcaacaaacatcgcaccatagtcgatcgc
cgctaa

DBGET integrated database retrieval system