KEGG   Pseudomonas trivialis: AA957_02335Help
Entry
AA957_02335       CDS       T04006                                 

Definition
(GenBank) acetoin dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ptv  Pseudomonas trivialis
Pathway
ptv00010  Glycolysis / Gluconeogenesis
ptv00020  Citrate cycle (TCA cycle)
ptv00620  Pyruvate metabolism
ptv01100  Metabolic pathways
ptv01110  Biosynthesis of secondary metabolites
ptv01120  Microbial metabolism in diverse environments
ptv01200  Carbon metabolism
Module
ptv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ptv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AA957_02335
   00020 Citrate cycle (TCA cycle)
    AA957_02335
   00620 Pyruvate metabolism
    AA957_02335
Enzymes [BR:ptv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AA957_02335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Biotin_lipoyl Hydrolase_4 Thioesterase Peptidase_S9 Esterase PGAP1 Abhydrolase_5 Ndr GCV_H DUF915 Abhydrolase_3 DUF676 DUF1100
Motif
Other DBs
NCBI-ProteinID: AKS04995
UniProt: A0A0H5A640
LinkDB All DBs
Position
complement(545416..546519)
Genome map
AA seq 367 aa AA seqDB search
MIHTLTMPKWGLSMTEGRIDVWLKQPGDRVEKGEEVLDVETDKISSSVEAPFSGVLRRVL
ALSDETLPVGALLGIVVEGEATEAQIDAVIESFNAGFVSSSAEAEAAGPSAQKVEIGGRL
LRYLDLGEGGTPLVLVHGFGGDLNNWLFNQPALAAERRVIALDLPGHGESGKHLQDGDAQ
ELSQAVLDLLDHLDLDRVHLAGHSMGGLVSLTVAGQAPERVASLTLIASAGLGPDINGDY
LQGFAEANNRNALKPQLTQLFSDPALVTRQMLEDMLKFKRLEGVDQALRQLNQKLFEGGR
QMIDVRNVVGRQPSLVIWGSEDAIIPAGHAEGLDAQVEIVPGQGHMVQLEAAEHVNQLMA
AFLKSQA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgatccataccctgaccatgcccaagtgggggctgtcgatgactgagggccgcatcgac
gtctggctcaagcagcccggtgaccgagtggagaagggcgaggaagtgctggacgtggag
accgacaagatctccagcagtgtcgaagcgcccttcagtggagtgttgcgccgggtgctg
gcgctgagcgacgagaccttgccggtgggcgcgttgctcgggattgtggtggaaggcgag
gccaccgaggcccagatcgatgcggtgatcgaaagcttcaacgccgggtttgtctcaagc
agcgccgaggccgaagcagccgggccgagcgcgcagaaggtggaaataggcgggcgcttg
ctgcgctatctcgacctgggcgaaggcggcacgccgttggtactggtgcatgggtttggc
ggtgacttgaacaactggctgttcaaccaaccggcattggccgccgagcgccgcgtgatc
gccctggacctgccggggcacggcgagtcgggcaagcatctgcaagacggcgatgcgcag
gaactgagccaggcggtgttggacctgcttgaccaccttgatctcgaccgcgtgcacctg
gccgggcactccatgggtgggctggtttcgctgacggtcgctggccaggcacccgagcgt
gtcgcctcgctgaccctgatcgccagcgccggcctgggaccggatatcaacggtgattac
ctgcaagggtttgccgaggccaataaccgcaatgcgctcaagccgcagttgacccaactg
ttcagcgacccggcgctggtgacgcggcagatgctggaggacatgctcaagttcaagcgg
ctggaaggcgtggaccaggcattgcggcaactcaatcaaaagctgtttgagggcgggcgg
cagatgattgatgtgcgcaatgtggtgggccgacagccaagtctggtgatctgggggagt
gaggatgcaatcattccggccggccatgccgagggcttggacgcccaagtggagatagtg
ccggggcaggggcatatggtgcagttggaggcagcagagcacgtcaaccagctaatggca
gccttcctcaaatcccaagcctaa

DBGET integrated database retrieval system