KEGG   Pseudomonas trivialis: AA957_02375Help
Entry
AA957_02375       CDS       T04006                                 

Definition
(GenBank) methionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
ptv  Pseudomonas trivialis
Pathway
ptv00270  Cysteine and methionine metabolism
ptv00450  Selenocompound metabolism
ptv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AA957_02375
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AA957_02375
Enzymes [BR:ptv01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     AA957_02375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Met_gamma_lyase Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 GDC-P Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AKS05003
UniProt: A0A0H5A518
LinkDB All DBs
Position
555259..556494
Genome map
AA seq 411 aa AA seqDB search
MNNKHNAFGFSTRAIHHGYDPKDHHGALVPPIYLSATFAFPTAEYGAACFAGEASGHFYT
RISNPTLALLESRMATLENGEAAVAFSSGMGAIAATFWTLLRPGDEVIVSQTLYGCTFAL
LHHGIGEFGIKVRHVDLTDLAALQAALCPATRMIYCETPANPNLQLVDIAAVAALAHQQP
NVTVVVDNTYCTPYLQRPLDLGADVVVHSATKYLSGHGDITAGIAVSNQTLALRIRLQGL
KDLTGAVMSPQDASLLMRGLKTLALRMDRHCSNAQAVAEALQAHPAVERVTYPGLRSFPQ
YALATRQMKMPGGMIAFELKGGIEMGRRFMNALKLFTRAVSLGDAESLAQHPASMTHSTY
TPEERARHGISEGLVRLSVGLEDVADLLADVQQALAKCARAAPRRTPLVSV
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataaacacaatgcattcggcttttccacccgcgcgatccaccacggctacgac
ccgaaggaccaccacggcgcgctcgttccaccgatttacctgtcggcaaccttcgctttc
ccaaccgctgaatatggcgccgcctgttttgccggcgaagccagtggtcacttctacacg
cgcatttccaacccgaccctggcgctgctggaatcgcgcatggcgaccttggaaaacggt
gaggcggcggtggcgttcagctccggcatgggagcgattgcggcgacgttctggaccctg
ttgcggcccggcgatgaagtgatcgtcagccagaccctctacggctgtaccttcgccctg
ctgcaccatggcatcggcgaattcgggatcaaggtgcggcacgtcgacctgactgacctg
gccgccctgcaagccgcactctgccccgccacccgcatgatctattgcgaaaccccggcc
aaccccaacctgcaactggtggatatcgccgccgtggcggctctcgcccaccagcagccc
aacgtgaccgtagtggtcgacaacacctactgcacgccctacctgcaacgccctctcgac
ctgggcgcggatgtggtggtgcattcggcgaccaaatacctcagcggccacggcgatatc
accgcgggcattgcggtgagcaaccagaccctggccctgcgtattcgcctgcaaggtctc
aaggacctgaccggcgcagtgatgtcaccccaggacgcctcgctgttgatgcgcggcctc
aagaccctggccctgcgcatggaccgccattgcagcaacgcccaggccgtggccgaagcc
ctgcaggcgcacccggccgtggagcgggtgacgtatccagggttgcgctccttcccacaa
tacgcactggcgacgcggcagatgaaaatgcccgggggcatgattgcctttgaactcaag
ggcggcatcgagatgggacgtcgtttcatgaatgcactcaagctgtttacccgcgcggtc
agcctgggcgacgctgagtcactcgcgcagcacccggcgagcatgacccattccacctac
accccggaggaacgcgcccgacacggtatcagcgaagggctggtgcgtttgtcggtgggg
cttgaggacgttgcggacttgctggcggatgtgcagcaggcactggccaagtgcgcgcgc
gccgcgccgcgtcgtactccgcttgtgagtgtttaa

DBGET integrated database retrieval system