KEGG   Pseudomonas trivialis: AA957_02565Help
Entry
AA957_02565       CDS       T04006                                 

Definition
(GenBank) hypothetical protein
Organism
ptv  Pseudomonas trivialis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF726 DUF900
Motif
Other DBs
NCBI-ProteinID: AKS05037
UniProt: A0A0H5ALU3
LinkDB All DBs
Position
complement(626939..628492)
Genome map
AA seq 517 aa AA seqDB search
MQHQWDEMHRTRKPTFVLCGEPQGDVLNLYVHGYSAFFNRQQLGSFKAQLAGIEGSTNLM
LFWPAGHFLENLFAPFKDVLGAMLSGGNLGAATVGVGKAIAYFLDHYKSVEARVDEVARS
LLPELASYLHGESLEVRRINLIGHSLGARILVKSLLASPETARELPLDNLLLMGGAICTS
SPWDEVSAPLKGRVINCHSSKDWALAMKPDTERCIGRYAIPVTPALKAKVTNVHLATFDH
AAYWPQLQTVVQYTDLLHERRGMIRSDQRSSEVRFAEEDAELFPALVQARPEELKFLAEL
MAQKRSASIDATVREPLKLAIELQRMGGDTFMNLARGHGVSYRQIAEDVVQRLGIKFDGL
LDSVELADLEAQVAEKLIEQYKDKLSNADRQVFDAQLKAAAQKEQGLFSRFDVGRSATTA
LSGTALAGLTGFILRRGAATAIPVVGQAVAAAMLLVSGVRAFSGPAYSITTLAVLVIGLI
RQRMEREAMSQEMDLVVQVVEAFDLPRETVMRTVASD
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaccagtgggatgaaatgcaccgcacccgcaaacccacgttcgtactgtgtggc
gagccccagggcgatgtgctcaatctctacgttcacggttattcggcattcttcaaccgg
caacaattgggcagcttcaaggcgcagttggcgggcatcgaaggctcgaccaacctgatg
ctgttctggccggcggggcatttcctggaaaacctgtttgctcccttcaaggatgtactg
ggcgcgatgctcagcggcggcaacctgggcgcggcgactgtgggggtgggcaaggcgatt
gcttatttcctcgatcactacaaaagcgtcgaggctcgggtggacgaagtcgccaggagc
ctgttgccggaactcgccagctacttgcacggtgagtcccttgaagtacggcgtatcaat
ctgatcggccactccctgggcgcgcgcattctggtcaagagtctgttggccagccctgaa
actgcccgcgaactgccattggacaacctgttgttgatgggcggcgcgatttgcacgtcg
agcccttgggatgaagtctcggcaccgctcaaaggacgtgtgatcaactgccactccagc
aaagactgggccctggcgatgaaaccggataccgaacgttgcatcggccgttatgcgatc
ccggtgacacccgcgctcaaggccaaggttaccaatgtgcacctggcgaccttcgatcat
gccgcctattggccgcagttgcagacggtggtgcagtacaccgacctgttgcacgagcga
cgcggcatgatccgttccgatcaacgcagcagtgaggtacgttttgccgaagaggacgcg
gaactgttcccggcgctggtgcaggcacgaccggaggagttgaagttccttgctgagttg
atggcgcaaaagcgcagcgcgtcaatcgacgccacggtgcgcgaaccactcaaattggcc
atcgagttgcaacgcatgggcggcgatacctttatgaacctggcccgcggccatggcgtg
agttaccgccagatcgccgaagatgtggtgcagcggttggggatcaagtttgacggactt
ctcgatagcgtcgaattggcagacctggaagcccaggttgcggaaaaactcatcgaacaa
tacaaagacaaactcagtaacgctgaccggcaggtgttcgacgcgcagctcaaggcggcc
gcgcaaaaggagcaggggctgttcagccgtttcgatgttggccgatcagccaccactgcg
ttgagtggtacggcgttggccgggctgaccgggtttatcctgcgccgtggtgcggccacg
gcgattccggtggtggggcaggctgtggcagcggcgatgctgctggtgagcggtgtacgc
gcgttttccggccctgcgtattcgatcaccaccctggcggtactggtgattgggttgatc
cgccagcgcatggagcgtgaagcgatgagccaggagatggacctggtggtgcaagttgtc
gaagcgttcgatctgccgcgggagacggtgatgcgcacggttgcgtctgactga

DBGET integrated database retrieval system