KEGG   Pseudomonas trivialis: AA957_02705Help
Entry
AA957_02705       CDS       T04006                                 

Definition
(GenBank) general secretion pathway protein GspF
  KO
K02455  general secretion pathway protein F
Organism
ptv  Pseudomonas trivialis
Pathway
ptv03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ptv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AA957_02705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ptv02044]
    AA957_02705
Secretion system [BR:ptv02044]
 Type II secretion system
  General secretion pathway protein
   AA957_02705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSF
Motif
Other DBs
NCBI-ProteinID: AKS05062
UniProt: A0A0H5ALW6
LinkDB All DBs
Position
complement(666929..668140)
Genome map
AA seq 403 aa AA seqDB search
MNRYRYEAADASGKVEAGHVEADSQSAAFANLRSRGLTALLVQIEGGQPAAAGSSLFTAK
LSDNDLAWATRQLASLLGASLPLEAALSATVEQAEKKHIAQTLAGVRADVRGGMRLAEAL
AARPRDFPSIYRALIAAGEESGDLAQVMERLADYIEERNNLRGKILTAFIYPGVVGLVSI
GIVIFLLSYVVPQVVSAFSQARQDLPGLTLAMLNASDFIRAWGWLCFAGIVGGFWSWRLY
LRNPVARLNWHSRVLRLPLIGRFVLGLNTARFASTLAILGGAGVPLLRALEAARQTLSND
RLSQCVNDATAKVREGVNLAPALAVEKVFPPVLIHLIASGEKTGSLPPMLERAAQTLSRD
IERRAMGMTALLEPLMIVVMGAVVLVIVMAVLLPIIEINQLVT
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctatcgctacgaggccgccgatgccagcggcaaagtcgaggccgggcatgtg
gaggccgacagccagagtgcggcctttgccaatttgcgcagccgcggtttgaccgcgttg
ctggtgcagatcgaaggcggccagccagcggcggcgggcagcagcctgttcactgccaaa
ctctcagacaatgatttggcctgggccacgcggcaactggcgagcctgctgggcgccagc
ctgccgttggaggcggcgttgagcgccacggtggagcaggccgagaaaaaacacatcgcc
cagaccctcgccggtgtgcgcgccgatgtgcgtggcggcatgcgcctggcggaggcgttg
gcggcgcggccacgggattttccgtcgatctaccgcgcgctgatcgcggcgggggaggag
tccggcgacctggcccaggtgatggagcgcctcgccgactacatcgaggagcgcaacaac
ctgcgcggcaagatcctcactgcgttcatctaccctggcgtggtggggttggtgtccatt
ggcattgtgattttcctgttgagctacgtggtgccccaggtggtcagtgcgttttcccag
gcgcgccaggacctgccggggctgaccctggcgatgctcaacgccagtgactttatccgt
gcctggggttggctgtgtttcgccgggatcgtcggcggtttctggagttggcgcctgtat
ttgcgcaacccggtggcgcgtttgaattggcatagccgcgtcttgcgcctgccgctgatc
gggcgctttgtactgggcctgaacaccgcgcggtttgcctcgaccctggcgattctcggc
ggtgccggcgtgccgttgctaagggccttggaggcggcgcggcagaccctgtccaatgac
cgcctgagccagtgcgtcaacgacgccaccgccaaagtgcgcgaaggcgtcaacctggct
ccggcgctggcggtggaaaaggtgttcccgccggtgctgatccacctgatcgccagcggc
gaaaaaaccggctcgctgccgccgatgctcgagcgcgcggcgcagaccctgtcgcgggat
atcgaacgccgcgccatgggcatgaccgcgttgctggaaccgctgatgatcgtggtgatg
ggcgccgtggtactggtgatcgtcatggcggtgctgttgccgatcatcgagatcaaccag
ttggtcacctga

DBGET integrated database retrieval system