KEGG   Pseudomonas trivialis: AA957_02955Help
Entry
AA957_02955       CDS       T04006                                 

Definition
(GenBank) aldose epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ptv  Pseudomonas trivialis
Pathway
ptv00010  Glycolysis / Gluconeogenesis
ptv00052  Galactose metabolism
ptv01100  Metabolic pathways
ptv01110  Biosynthesis of secondary metabolites
ptv01120  Microbial metabolism in diverse environments
ptv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ptv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AA957_02955
   00052 Galactose metabolism
    AA957_02955
Enzymes [BR:ptv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AA957_02955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AKS05111
UniProt: A0A0H5A2T5
LinkDB All DBs
Position
716502..717650
Genome map
AA seq 382 aa AA seqDB search
MKHPRYLLSGLAMSVLIASGGAHAAGLTSEHKPFGKTNDGTAVEQYILRNSHGMQATVIT
YGGVLQSLKVPDKNGKVDDVVLGFDDVQGYQAGTAFFGATIGRFGNRLAGGAFELDGKRF
QVPLNDGPNSLHGGAQGFDKQVWKAAQVKGKDSVGVTLTYLSKDGEMGFPGNLKTEVTYS
LNEKNELHIDYKATTDKPTVLNLTNHSYFNLAGAGNGDILKQVATLHASHYTPVNATLIP
TGEVAPVKGTPMDFLKPTPIGQHIKEDHPQLKFAEPKQGGFDFNWALDTKGDVKQLAAEV
HDPESGRRLQLYTTEPGVQFYTSNFLDGSVKGKAGKTYLHWSGFTLETQHFPDAPNQPKF
ASTRLNPGQTYTQNTVFKFSAD
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaccctcgttatctgctgtcaggtctcgccatgtctgtattgatcgccagtggc
ggcgcccacgccgcaggcctcaccagtgaacacaagcctttcggtaaaaccaacgatggc
accgccgtcgagcagtacattttgcgcaacagccatggcatgcaagccacggtgatcacc
tacggcggcgtgttgcagtcgctgaaagtgccggacaaaaacggcaaggtcgacgacgtg
gtgctgggctttgacgacgtgcagggctaccaggccggcacggcgtttttcggcgcgacc
atcgggcgcttcggcaatcgcctggccggcggcgcctttgaactcgacggcaaacgcttc
caggtgccgctcaacgatggccccaactcactgcatggcggcgcccagggcttcgacaaa
caggtgtggaaggccgcacaggtcaagggcaaggactcggtcggcgtcaccctcacctac
ctgtccaaggacggtgaaatgggcttccccggtaacctgaagaccgaagtcacctacagc
ctcaacgagaaaaacgaactgcacatcgactacaaggccaccaccgataaaccgacggtg
ctcaacctcaccaaccacagctacttcaacctcgccggtgcgggcaatggcgacattctc
aagcaggtcgcgaccttgcatgccagccattacacgccggtgaacgccaccttgattccg
accggcgaagtcgcgccggtgaaaggcacaccgatggacttcctgaaaccgacgccgatc
ggtcagcacatcaaggaggatcatccgcagctcaaattcgccgagccgaaacagggcggg
tttgacttcaactgggcactcgataccaagggtgacgtgaagcaattggcggccgaggtg
catgatcctgagtcggggcggcggttgcagctctacaccacggagcccggtgtgcagttc
tataccagtaacttcctcgatggttcggtgaagggcaaggctgggaagacgtacctgcac
tggagcgggttcaccctggagacccagcattttccggatgcgcctaaccagccgaagttt
gcgtctacccgtttgaacccagggcagacctacacccagaacactgtcttcaagttctcc
gccgattaa

DBGET integrated database retrieval system