KEGG   Pseudomonas trivialis: AA957_11500Help
Entry
AA957_11500       CDS       T04006                                 

Definition
(GenBank) carbohydrate kinase
  KO
K17758  ADP-dependent NAD(P)H-hydrate dehydratase [EC:4.2.1.136]
Organism
ptv  Pseudomonas trivialis
Brite
KEGG Orthology (KO) [BR:ptv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AA957_11500
Enzymes [BR:ptv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.136  ADP-dependent NAD(P)H-hydrate dehydratase
     AA957_11500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carb_kinase Phos_pyr_kin HK
Motif
Other DBs
NCBI-ProteinID: AKS06710
UniProt: A0A0H5AAR6
LinkDB All DBs
Position
complement(2570610..2571470)
Genome map
AA seq 286 aa AA seqDB search
MPQTKHAITDVQTLLPGHLPQLAARSPDAHKGQFGHLLVIGGDRGFGGAALLSAESALRS
GAGMVSLATRLEHVPAALARLPEVMTVGVSSANQLMGLLEKISVIVIGPGLGDASWGKSL
LSVAANAKQPQVWDADALNQLATGSVVLPANCVITPHPGEAARLLGISTAEVQADRLKVA
RALSQTFNAVTILKGAGSLIASPDGRVSRCDQGHPAMATAGLGDVLAGLVGALLAQGMHA
YEASCLAVWLHATAGDRQGTFGRGLAASDLIPAIRQLLEEQSPCLK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagacaaaacacgcaataaccgacgtacagaccctgttgcccggccatttgccg
caactggctgcgcgttccccggacgcccataaaggccagttcggccacctgctggtcatc
ggcggtgaccgcggctttggcggcgctgcgctgttgagcgccgaaagtgccttgcgcagt
ggcgccggcatggtgtccctggcaacgcgcctggagcacgtgcctgctgcgttggcgcgt
ttgccggaagtcatgaccgtgggtgtcagctcggcgaatcaattgatgggcttgctggaa
aagatttcggtcatcgtaatcgggccagggctcggtgacgcttcctggggcaaaagtctg
ctttctgtcgctgccaacgctaagcagccgcaagtctgggacgccgacgccttgaatcag
ctcgccaccggcagcgttgtcctgccggccaattgcgtgatcaccccgcatccaggggag
gccgcgcgcttgttgggcatttcgacagccgaggttcaggccgatcgccttaaggtggcg
cgcgcgttgagccagacattcaatgcagtgactatcctcaagggtgctggcagtttgatt
gccagcccagacggacgtgtttcgcgatgtgaccaaggccacccggcgatggcaacggca
gggctgggcgatgtattggccggcctggtgggcgcattgctggcccagggcatgcacgcc
tatgaagcaagctgcctggccgtgtggttgcatgccacggcgggggatcgccagggtact
tttggtcgcgggttggctgcgagcgacctgatacccgccattcgtcaattgttggaggaa
cagtcgccgtgcctgaagtaa

DBGET integrated database retrieval system