KEGG   Pseudomonas trivialis: AA957_11800Help
Entry
AA957_11800       CDS       T04006                                 

Definition
(GenBank) O-acetylhomoserine aminocarboxypropyltransferase
  KO
K01740  O-acetylhomoserine (thiol)-lyase [EC:2.5.1.49]
Organism
ptv  Pseudomonas trivialis
Pathway
ptv00270  Cysteine and methionine metabolism
ptv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AA957_11800
Enzymes [BR:ptv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.49  O-acetylhomoserine aminocarboxypropyltransferase
     AA957_11800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase GDC-P
Motif
Other DBs
NCBI-ProteinID: AKS06769
UniProt: A0A0H5A6V5
LinkDB All DBs
Position
2644514..2645791
Genome map
AA seq 425 aa AA seqDB search
MKDATIALHHGFKSDPTTKAVAVPIYQNVAFEFDNAQHGADLFNLDVPGNIYTRIMNPTN
DVLEQRIAALEGGIAALAVSAGSAAIHYAIQTLTRAGDNIVTTPQLYGGTYTLFAHLLPS
FGVDVRFAQDDSAEAIAALIDDNTKLVYCESIGNPAGNIVDLEALAKVAHARGVPLMVDN
TVATPVLCKPIQFGADIVVHSVTKYIGGHGNSLGGVIVDSGTFPWTDYPEKFPGLNTPEP
AYHGVVYTEKFGPAAFIARARTVPLRNTGAALAPMNAFLLLQGLETLALRMERHTDNALK
VAQFLQDHADVEWVSYAGLPDHPHHELAQKYMQGKPSAILSFGLKGGYEAGVRFYDALQI
FKRLVNIGDAKSLACHPASTTHRQMNGQEQAKAGVKPEMIRLSVGIEAIEDLIEDLQQAL
GSTQL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgccaccatcgcattgcaccacggcttcaagtcggacccgaccaccaaggcc
gtcgccgtgccgatctatcagaatgtcgctttcgaattcgataacgcccagcacggcgcc
gacctgttcaacctggacgtacccggcaatatctacacacggatcatgaaccccaccaac
gatgtgctggagcagcgcattgccgcccttgaagggggtattgcggccctggcggtgtcg
gctggcagcgcggcgatccattatgcgatccagaccctcacccgtgccggcgacaatatc
gtcaccaccccgcaactctacggcggcacctacaccttgttcgcgcacttgctaccgagc
ttcggcgtcgatgtacgtttcgcccaagatgactctgcagaagccatcgccgcgttgatc
gacgacaacaccaagctggtgtactgcgaaagcatcggcaacccagccggcaatatcgtc
gacctggaagccttggccaaggtggctcacgcccgtggcgtgccgctgatggtggataac
accgtggccacgccggtcctgtgcaagccgatccagttcggcgccgatatcgtggtgcac
tcggtgaccaaatacatcggtggccacggcaattccctgggcggtgtgatcgtcgacagt
ggcaccttcccctggaccgactacccggagaaattccccggcctcaacacccccgagccg
gcctatcacggcgtggtctacacggaaaaattcggccccgccgccttcatcgcccgcgct
cgcaccgtgccgctgcgcaacaccggcgcggcgctggcaccgatgaatgctttcctgcta
ttgcagggcctggaaaccctggcgctgcgcatggagcgccacaccgacaacgccctgaaa
gttgcgcaattcctgcaagaccacgcggatgtcgagtgggtcagctacgccggcctgcca
gaccatccacatcacgaattagcgcaaaaatacatgcagggcaaaccgtcggcgatcctg
tcgtttggcctaaaaggtggttacgaggccggtgtgcgcttctacgacgcgctgcagatc
ttcaagcggttggtgaacatcggtgatgccaaatccctggcctgtcaccccgcctctacc
acgcatcggcagatgaacgggcaggaacaagccaaggccggcgtgaagccggagatgatt
cgcctgtcagtcggtatcgaggcgattgaagacctgatcgaagatctgcagcaggcactg
ggctcaactcagctctga

DBGET integrated database retrieval system