KEGG   Pseudomonas trivialis: AA957_15080Help
Entry
AA957_15080       CDS       T04006                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
ptv  Pseudomonas trivialis
Pathway
ptv02025  Biofilm formation - Pseudomonas aeruginosa
ptv03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ptv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AA957_15080
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    AA957_15080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptv01001]
    AA957_15080
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ptv02044]
    AA957_15080
Enzymes [BR:ptv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AA957_15080
Protein kinases [BR:ptv01001]
 Serine/threonine kinases: Other
  Bacterial family
   AA957_15080
Secretion system [BR:ptv02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   AA957_15080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal VWA_2 TssR Kinase-like Kdo
Motif
Other DBs
NCBI-ProteinID: AKS07379
UniProt: A0A0H5A8K2
LinkDB All DBs
Position
3376270..3379248
Genome map
AA seq 992 aa AA seqDB search
MNIVIPGYDIEGEIGEGAMASVYLATQRSLERKVALKVMAAALAADPSFCERFLREGKTL
ARLSHPHTVTIHDIGNVGELYYMAMEYLPNGTLKERIAAGLTPEQGVTLIRQIASALGYA
HAQGLVHRDVKPANILFRADGTAVLSDFGIAKSLDDRTQFTQAGFAVGTPSYMSPEQARG
QEIDGRADLYALGVVLYEILVGKLPYSGTDALSTALAHLTEPLPELPVHHGRYQGVLRKL
LAKDPAERFPDAAALLLALDQLPADSPEATLVRPLPIPLSFDLGGMTPVTIDIPTDKPQP
QPVVRQPVVTPTQHKAVSEQRRGPVLALAAVAVAVALAIGGASYWWLSGSEEPAKPPAAV
VPKVTPPPPPVAEVDGGQRPLLMAGKKTLFQRVLSKPGAKLSTDAGSAPGKALPAFSVLY
VYQRKDVDGSPWVRVGAATDGRSDGWLPAAQVSDWKQSLVLKFTERSGRAPVMFLRQSGE
VEKLLADPAAAKGVLAKAQKNSEDNSQILALEPTASAVPQNQFYLLPIFDSKESFDENGQ
PVQLLNVASIDPGTSAVKPATPVIKANADAFRTAVVLVVDTTVSMQPYIDQIRDVVHELQ
TRIGERGELDSVSFGMVGFRSSIKKTPGLEYVAKTLISLDQGRDPQRFLDMARQVKASTV
SSHSFNEDAFAGVMQAVDGMDWSGYGGRIILLVTDAGALRKNDPFAATQMNEAEVRQAAL
GKQIKIYALHLRTDAGKKIHAGAESQYRILTADANPQIGDLYTPVPGGDVRKLGERVDEI
GTVFANLVHQVRSNTPQPVPLLSSAPTLADKSAAVGYAMHMDFLGRKTASQAPQLVSAWT
ADRDLTNPALPAFQVCVMLTKLQLNDLQQSLKLIVDAARKTQTSPKDFFQEIASASAYMS
RDPQALRKGGNLADGGILGEYLEGLPYRSKSLNMTQDLWLSLSVAEQEDFIDELDSKIRL
YETFHNDVANWVRFGDAEPGDALYRVPLSTLP
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgtcatcccgggttatgacatcgaaggcgagatcggcgaaggcgccatggcc
agcgtgtacctggcgacccagcgttcgctggagcgcaaggtggcgttgaaggtgatggcg
gcggcactggcggccgacccgagcttttgcgagcgtttcctgcgcgagggcaagaccctg
gcgcgcttgtcgcacccgcacacggtgaccatccatgacatcggcaatgtcggtgagctg
tattacatggcgatggaatacctgcccaacggcacgctcaaggagcgcattgccgctggg
ctgacgccggagcagggcgtgacactgatccgccagatcgcttcggcgttgggctatgcc
cacgcccaaggcctggtgcaccgcgatgtgaagccggcgaacattctgtttcgcgccgat
ggcacggcggtgctgtccgacttcggtatcgccaagtcgctggatgaccgcactcaattc
acccaggccggttttgccgtaggcacgccgagctatatgagcccggaacaggcgcggggc
caggagatcgacggccgcgccgacctgtatgcgctgggcgtggtgctgtatgaaatcctc
gtcggcaagctgccctacagcggcaccgatgcgctttcgactgcgctcgcacacctgacc
gagccgttgccggaattgccggtgcaccacgggcgttatcagggcgtgctgcgcaagctg
ttggccaaggacccggcggaacgcttcccggatgcggcggcgttgttgctggcgctggac
caactgccggcggattcaccggaggccacgctggtgcggccgctgccgatcccgctgagc
tttgatctggggggcatgaccccggtcaccatcgatattccgaccgataaaccacagccg
caaccggtggtgcgccaacctgtggtgaccccgacgcaacacaaagccgtgtccgagcaa
cgccgtgggccggtgttggcgctggccgctgttgcggtagcggttgcactggccattggt
ggcgccagttattggtggttgagcggtagcgaagagccggccaagccgcctgctgcggtg
gtgcccaaggtgacgccaccaccaccgccagtcgctgaagtggatggcggtcagcgcccg
ctgttgatggcgggtaagaagaccctgttccagcgcgtgctcagcaagcccggcgcgaag
ctttcaacggacgcaggcagcgcgccaggaaaagccctgccagcgttctccgtactctat
gtttaccagcgcaaagacgtcgatggcagcccgtgggtacgggttggcgcggccaccgat
gggcgcagcgatggatggctgccggccgcgcaggtcagcgactggaagcagagcctggtg
ctgaaattcaccgagcgctcggggcgggccccggtgatgttcctgcgtcaatccggtgaa
gtcgaaaagctgttggccgacccagctgccgccaagggcgtgctggccaaggcgcagaaa
aacagcgaagacaatagccagatccttgccctggaaccgactgccagcgctgtgccgcag
aaccagttctatctgttgccgatcttcgattccaaagagagcttcgacgaaaacggccag
ccggtgcagttgctcaatgtcgcttccatcgacccaggcaccagcgcggttaaaccggcc
acgcctgtgatcaaagcgaatgccgatgccttccgcacggccgttgtattggtggtcgac
accaccgtgtcgatgcagccctacatcgaccagatccgcgatgtggtgcacgaactgcaa
acccgcatcggcgagcgtggcgagttggacagtgtcagcttcggcatggtgggttttcgc
agcagcatcaagaaaacccctggcctggaatacgtcgccaagaccctgatcagcctcgac
cagggtcgcgacccgcaacgcttcctcgacatggcgcggcaggtcaaggcgtccaccgtg
tccagtcattcgttcaacgaagatgcgttcgccggggtgatgcaagcggtggatggcatg
gattggtccggttacggcgggcgcatcatcctgctggtcaccgatgctggtgcgctgcgc
aagaacgatccgtttgccgccacccagatgaacgaggcggaagtgcgtcaggccgcgctg
ggcaagcagatcaagatctacgccctgcacctgcgcaccgacgccggtaagaaaatccac
gccggtgccgaaagccagtaccgcatcctcaccgccgacgccaacccgcagattggcgac
ctttacacgccggtgccgggtggcgacgtgcgcaagctgggcgagcgcgtcgatgagatc
ggcacggtgttcgccaacctggtgcatcaggtgcgcagcaacacgccgcagccggtgccg
ttgctgagttctgcgccaaccctggcagacaaatccgcagcggtcggctatgccatgcac
atggacttcctggggcgcaaaaccgcaagccaggcgccgcaactggtcagcgcctggacc
gccgaccgcgacctgaccaacccggcgctgccggcgttccaggtgtgcgtgatgctgacc
aaattgcagctcaacgacctgcagcagtcgctgaaactgatcgtcgatgcggcgcgcaag
acccagacctcacccaaggatttcttccaggaaatcgccagcgcctcggcctacatgagc
cgcgatccgcaagccttgcgcaagggcggcaacctggccgacggcggcatcctcggtgaa
tacctcgaaggcctgccgtaccgcagcaaatcgctgaacatgacccaggacctgtggttg
tcgttgagcgtggccgagcaggaagactttatcgacgagctggattcgaaaatccgcctc
tacgagaccttccacaatgacgtggccaattgggtccgtttcggcgatgccgagccgggt
gatgcgttgtaccgcgtgccgttgtcgacgctgccgtga

DBGET integrated database retrieval system