KEGG   Pseudomonas trivialis: AA957_16550Help
Entry
AA957_16550       CDS       T04006                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ptv  Pseudomonas trivialis
Pathway
ptv00473  D-Alanine metabolism
ptv01100  Metabolic pathways
ptv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ptv00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AA957_16550
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AA957_16550
Enzymes [BR:ptv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AA957_16550
Peptidoglycan biosynthesis and degradation proteins [BR:ptv01011]
 Precursor biosynthesis
  Racemase
   AA957_16550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AKS07665
UniProt: A0A0H5ADE0
LinkDB All DBs
Position
complement(3681781..3683010)
Genome map
AA seq 409 aa AA seqDB search
MPFSRSLLALSMGLVLLHNPAFAAPPLSMTDGVAQVHTQDSNAWVEISKAAFEHNIRTLQ
TTLADKSKICAVLKADAYGHGIGLLMPSVIQLGVPCVGVASNEEIRVVRESGFKGQLIRV
RTAALSELEAALPYNVEELVGNLDFAVRASLIAENHGRPLVVHLGLNSSGMSRNGVEMTT
AQGRRDAVAITKVPNLEVKAIMTHFAVEDAADVRTGLKAFNEQAQWLINVAQLDRSKITL
HAANSFATLEVPESRLDMVRPGGLLFGDTVPSFTEYKRVMQFKSHVASVNSYPKGNTVGY
DRTYTLARDSKLANITVGYSDGYRRAFTNKGTVLINGHRVPVVGKVSMNTLMVDVTDVPT
VKSGDEVVLFGKQGNVQTTQAEVEDINGALLADLYTVWGNSNPKVLVDK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcccttctctcgttccctgctcgccctgtccatgggcctggttctgctgcacaaccca
gccttcgccgccccgccgttgtcgatgaccgacggggtggcgcaagtgcacacccaggac
agcaacgcctgggtcgaaatcagcaaagctgcgttcgaacacaacatccgtaccctgcaa
accaccctcgccgacaaatcgaagatctgcgccgtgctcaaggcagatgcctacggccat
ggcatcggtttgctaatgccctccgtcattcaactgggcgtcccttgcgtcggcgttgcc
agtaacgaagaaatccgcgtcgtacgcgaaagcggcttcaaaggccaactgatccgcgtg
cgcactgctgcgttgagcgaactggaagccgcgctgccgtacaacgtcgaagaactggtg
ggcaacctcgacttcgccgtgcgcgccagcctgatcgccgaaaatcacggccgcccgctg
gtggtgcacctgggcctgaactccagcggcatgagccgcaacggcgtggaaatgaccacc
gcccaaggccgtcgcgatgccgtcgccatcaccaaagtgccgaacctggaagtgaaggca
atcatgacccacttcgccgtcgaagacgccgccgatgtgcgaaccgggctcaaggccttc
aacgagcaggcgcagtggctgatcaacgtcgcgcaattggatcgcagcaagatcaccctg
cacgcagccaactcgttcgcgaccctcgaagtaccggagtcgcgcctggacatggtgcgc
cccggcggcctgttgtttggcgacaccgtgccgtcgtttaccgaatacaaacgcgtgatg
cagttcaagtcccacgtcgcgtcggtgaacagctatcccaagggcaacaccgttggctat
gaccgcacctacaccctggcgcgtgattccaagctggcaaacatcaccgtgggctattcc
gatggctaccgccgtgcgtttaccaacaaaggcaccgtgctgatcaatgggcatcgtgta
ccggtggtgggcaaagtgtcgatgaacacgttgatggtcgacgtgaccgatgtaccaaca
gtgaagagcggggatgaggtggtgctgtttggcaagcaggggaatgtgcagacgacgcaa
gctgaggtagaagatatcaacggcgcattgttggcggacttgtatacggtgtggggtaac
tcgaatccgaaagtgctggtggataagtaa

DBGET integrated database retrieval system