KEGG   Pseudomonas trivialis: AA957_18850Help
Entry
AA957_18850       CDS       T04006                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
ptv  Pseudomonas trivialis
Pathway
ptv00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ptv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AA957_18850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ptv01003]
    AA957_18850
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ptv01011]
    AA957_18850
Enzymes [BR:ptv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     AA957_18850
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AA957_18850
Glycosyltransferases [BR:ptv01003]
 Polysaccharide
  Bacterial polysaccharide
   AA957_18850
Peptidoglycan biosynthesis and degradation proteins [BR:ptv01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   AA957_18850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase UvrB_inter
Motif
Other DBs
NCBI-ProteinID: AKS08096
UniProt: A0A0H5AAV4
LinkDB All DBs
Position
4173989..4176313
Genome map
AA seq 774 aa AA seqDB search
MTRTRSPRSRKKPPSRGLRPWLGWALKLGLVGLVVLAGFAVYLDAVVQEKFSGKRWTIPA
KVYARPLELFTGQKLSKDDFLTELDALGYRREPVSNGPGAAAVTGNTVDLNTRGFQFYEG
LEKAQPVRVRFSGDYVAELSSLNGSKLPVVRLEPLMIGGIYPKNLEDRILIKLDQVPPYL
LETLVAVEDRDFYHHWGVSPKSIARAVWVNTSGGKMTQGGSTLTQQLVKNFYLTSERSLT
RKLTEAMMAMLLELHYSKQEILEAYLNEVFVGQDGQRAVHGFGLASQFFFGQPLSELKLH
QVALLVGMVKGPSYYNPRRNPERALERRNLVLDVLEQQGVATAEQVAAAKKMPLGVTTRG
KLADSSFPGFIDLVKRQLREDYRDEDLTEEGLRIFTSFDPILQMKAEASVNDTFKRLTGR
KGSDEVEAAMVVTNPETGEVQAMIGSRQASFAGFNRALDAVRPIGSLVKPAVYLTALEKP
SKYTLTSWLSDDPLSVKGADGQVWTPQNFDRRSHGTVFLYQGIAHSYNISTSRLGLEVGV
PNVLKTIARLGVTREFPAFPSILLGAGAMTPMEVATMYQTLANGGFNTPMRGIRSVLTAE
GEPLKRYPFQIQQRFDAGSIYLIQNAMQRVMREGTGRSVYSVLPANLTLAGKTGTSNDSR
DSWFAGFGQDVLAVVWLGRDDNGKTPFTGATGALQVWTSFMRKADPLPLNMPQPDNIVQA
WIDPHTGQGSDANCPGAVQMPYIRGSEPPPGAACGGSAPADAESVMDWVKGWMN
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgactcgaacccgatctccccgttcccgtaaaaaacctccctcccgtggcctgcgccct
tggctgggctgggcgctcaagcttggcttggtgggcctcgtcgtgctcgccggctttgcg
gtgtacctcgacgctgtggtccaggagaaattctccggcaagcgctggaccattccggcc
aaggtgtacgcgcgtccactggaactgttcaccggccagaagctgagcaaggacgacttc
ctgaccgagctcgacgctttgggctaccgccgcgaacccgtgagcaacggtccgggtgcg
gccgccgtcacgggcaacaccgtcgacctgaatacccgtggcttccagttctatgaaggc
ctggaaaaagcccagccggtgcgcgtgcgcttttccggcgattacgttgccgagttgtcg
tcgctcaatggctcgaagctgcccgtggttcgcctggaaccgctgatgattggtggcatt
tacccgaaaaaccttgaagatcgcatcctgatcaagcttgatcaggtgccgccgtacctg
ctggaaaccctggttgccgttgaagaccgcgatttctaccaccactggggcgtctcgccg
aagtcgattgcccgcgcggtttgggtgaacacctctggcggtaagatgacccagggcggc
agtacgctcacgcaacaattggtcaagaatttctacctgaccagcgagcgcagcctgacc
cgtaagctcaccgaagccatgatggcgatgctgctggagctgcactacagcaagcaggaa
atcctcgaggcgtacctcaacgaggtgttcgtcggccaggacggccagcgcgccgtgcat
ggttttggcttggccagccagttcttctttggccagccgctgtctgaattgaagctgcat
caggtcgcgttgctggtgggcatggtcaaagggccttcctactacaacccgcgtcgtaat
cctgagcgcgcattggagcgtcgtaacctggtgctcgatgtgcttgagcagcagggcgtt
gccacggcggagcaagttgcggcggccaagaaaatgccactgggtgtcactacccgcggc
aagctggcggacagctccttcccaggctttatcgacctggtcaaacgtcaactgcgtgaa
gactaccgcgacgaagacttgaccgaagaaggcctgcggatcttcaccagtttcgatcct
attttgcagatgaaagccgaagcgtccgtcaacgataccttcaaacgcctgacggggcgc
aaaggttcggatgaagtcgaagcggcaatggtcgtgaccaacccggaaaccggcgaagtg
caggccatgatcggcagtcgccaggccagcttcgccggtttcaaccgcgcgctggatgcg
gtgcggccgattggctcgttggtcaagccggccgtttacctgaccgccttggaaaaaccg
agcaaatacaccctgaccagttggctgtcggacgatccactgtcggtcaaaggtgctgac
ggccaggtgtggacgccacagaacttcgaccgtcgctcccacggtacggtgttcctatat
caagggatcgcgcactcctacaacatctctacttcccgcctcggccttgaagtcggcgtg
ccgaacgtcctcaagaccatcgcgcgactgggtgttacccgtgaattcccggcctttccg
tcgatcctgctgggtgctggcgcgatgaccccgatggaagttgcgaccatgtaccagacc
ctggccaacggtggtttcaatacaccgatgcgcgggatccgtagcgtgttgactgccgaa
ggcgagccgctcaagcgttacccgttccagattcagcaacgtttcgatgcgggctccatc
tacctgatccagaacgccatgcagcgcgtgatgcgtgaaggtaccgggcgttcggtctat
agcgtgctgccggcaaacctgacattggccggcaagaccggtaccagtaacgactcgcgc
gacagttggtttgcgggcttcggccaggacgtgctggcggtggtgtggctggggcgcgac
gataatggcaagaccccgttcaccggtgccacgggtgcgctgcaggtctggaccagtttc
atgcgcaaggccgacccgttgccgttgaacatgccgcagccggataacatcgtgcaggcc
tggattgatccgcacacgggccaaggctccgatgccaactgtccgggcgcggtgcagatg
ccgtatattcgcggcagcgaaccgccacccggtgccgcgtgcggtggcagtgcccctgct
gacgcggaatcggtgatggattgggtcaagggctggatgaattaa

DBGET integrated database retrieval system