KEGG   Pseudomonas trivialis: AA957_19625Help
Entry
AA957_19625       CDS       T04006                                 

Definition
(GenBank) aminotransferase
  KO
K14287  methionine transaminase [EC:2.6.1.88]
Organism
ptv  Pseudomonas trivialis
Brite
KEGG Orthology (KO) [BR:ptv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ptv01007]
    AA957_19625
Enzymes [BR:ptv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.88  methionine transaminase
     AA957_19625
Amino acid related enzymes [BR:ptv01007]
 Aminotransferase (transaminase)
  Class I
   AA957_19625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AKS08240
UniProt: A0A0H5AF24
LinkDB All DBs
Position
4339314..4340462
Genome map
AA seq 382 aa AA seqDB search
MITSKLPNVGTTIFTTMSQLAAETGALNLSQGFPDFNGPQGLLDAVGKHVASGHNQYSPM
TGLPALRQQVAAKIARSYGAAIDADSEVTITPGATAAIFCAIQAVIRGGDEVIVFDPCYD
SYEPSVELAGGRCVHVQLSLQGFALDFEKIKAALSPRTRMIILNTPHNPTGALISRAELD
QLAELIRDRDIYLVSDEVYEHLVFDGVPHVSVLAHEELYQRAFVVSSFGKTYHVTGWKTG
YVVAPPALTAELRKVHQYVNFCGVTPLQFALADFMAEHPEHVAELPAFYQAKRDLFCDLL
APSRFSFTRVTGTYFQLVDYSQIRPDLDDVAMSLWMTREHGVATIPVSVFYQTPPQGQRL
VRLCFAKREETLQQAAEKLCVI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccagcaagctgccgaatgtcggcaccaccatcttcaccaccatgtcgcaactc
gctgccgaaaccggtgcgctcaacctgtcccagggcttcccggacttcaatggtccccaa
ggcttgctcgatgccgtgggcaagcacgttgccagcggacacaaccaatattcaccgatg
actggcctgccagccctgcgccagcaagtggcggccaagattgcccgcagctatggcgcc
gctatcgatgccgacagtgaagtcaccatcacccctggtgccacggcggcgatcttctgc
gcgatccaggcggtgattcgcggtggcgatgaagtcatcgtgttcgacccttgctacgac
agttacgagccctcggtggagctggccggtggccgttgcgtgcatgtgcaactgagcctg
caaggctttgcgctcgacttcgaaaagatcaaggccgcgctgtcgccgcgcacccgcatg
atcatcctcaacacgccgcacaaccccaccggcgccttgatcagccgcgccgagttggac
cagttggcggagctgatccgcgaccgcgatatctacctggtcagcgacgaggtctacgaa
cacttggtattcgacggtgtaccccatgtcagcgtgctggcccacgaagaactgtatcag
cgcgcgttcgtggtcagttccttcggtaagacctaccatgtcaccggctggaaaaccggc
tacgtcgtcgcgcccccggccctcacggccgagctgcgtaaggtgcatcaatacgtcaat
ttctgtggcgtaaccccgctgcagttcgcgctggctgacttcatggccgagcacccggaa
catgtggctgagctgccggccttctaccaggccaagcgcgacctgttctgtgacctgctg
gcaccgtcacgtttcagctttacccgcgtcaccggcacctacttccagttggtcgattac
tcacagatccgcccggatctggacgacgtcgccatgtccctgtggatgacccgcgaacac
ggcgtggcaaccatcccggtctcggtgttctaccagaccccaccccaaggccagcgcctg
gtgcgcctgtgctttgccaaacgcgaggaaacgctgcaacaagcagccgaaaaactatgc
gtgatctga

DBGET integrated database retrieval system