KEGG   Pseudomonas trivialis: AA957_23740Help
Entry
AA957_23740       CDS       T04006                                 

Definition
(GenBank) O-succinylhomoserine sulfhydrylase
  KO
K10764  O-succinylhomoserine sulfhydrylase [EC:2.5.1.-]
Organism
ptv  Pseudomonas trivialis
Pathway
ptv00270  Cysteine and methionine metabolism
ptv00920  Sulfur metabolism
ptv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptv00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AA957_23740
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AA957_23740
Enzymes [BR:ptv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.-  
     AA957_23740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 GDC-P Beta_elim_lyase Met_gamma_lyase SelA
Motif
Other DBs
NCBI-ProteinID: AKS09009
UniProt: A0A0H5ACZ6
LinkDB All DBs
Position
5248068..5249279
Genome map
AA seq 403 aa AA seqDB search
MSQEWDAGRLDSDLDGVAFDTLAVRAGQHRTPEGEHGDPMFFTSSYVFRTAADAAARFAG
EVPGNVYSRYTNPTVRAFEERIAALEGAEQAVATATGMAAILAVVMSLCSAGDHVLVSRS
VFGSTISLFEKYFKRFGIEVDYVPLADLSGWDAAIKTNTKLLFVESPSNPLAELVDIAAL
AEVAHAKGAMLVVDNCFCTPALQQPLKLGADIVVHSATKFIDGQGRCMGGVVAGRSEQMK
EIVGFLRTAGPTLSPFNAWIFLKGLETLSLRMKAHCANAQALAEWLEQQDGIEKVHYAGL
KSHPQHELAQRQQRGFGAVVSFEVKGGKDGAWRFIDATRLISITANLGDSKTTITHPSTT
SHGRLAPHEREAAGIRDSLIRVAVGLEDVADLQADLARGLAAL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggaatgggatgccggtcggttggacagcgacctcgatggcgtagctttcgat
accctggctgtgcgcgccggccaacaccgtaccccggaaggtgagcacggtgatccgatg
tttttcacgtccagctacgtgttccgcacggcggccgacgctgctgctcgtttcgctggc
gaggtgccgggtaacgtctattcgcgttacaccaacccgaccgtgcgcgcattcgaagag
cgtatcgcggcgctggaaggtgctgagcaggcggtggccacggcgaccggtatggcggcg
atccttgccgtggtgatgagcctgtgcagcgctggcgaccacgtgctggtgtcgcgcagc
gtgtttggttcgaccatcagtctgtttgaaaagtacttcaagcgcttcggcattgaggtg
gactacgtaccgttggccgacctgtctggctgggacgcggcgatcaaaaccaacaccaag
ttgctgttcgtcgagtcgccgtccaacccgttggctgagctggtggatatcgccgcgttg
gccgaagtcgctcacgccaagggcgcgatgctggtggtcgacaattgcttctgcaccccg
gcgctgcaacagccattgaagctgggcgcggatattgttgtgcactcggctaccaagttc
atcgatggccagggtcgttgcatgggcggtgtcgttgcaggtcgcagtgagcagatgaaa
gaaattgttggcttccttcgcaccgctggcccgaccctgagcccgttcaacgcctggatc
ttcctcaaaggcttggaaaccctcagcctgcgcatgaaggcccattgcgccaacgcccag
gccctggccgagtggctggagcaacaggacggcatcgagaaagtgcactacgccggtctc
aagagccacccgcaacacgagttggcccagcgccagcagcgtggtttcggtgccgtggtg
agctttgaggtgaagggtggcaaagacggtgcctggcgttttatcgatgccactcgcctg
atctctatcactgccaacctgggtgacagcaagaccaccattactcacccgagcaccacc
tcccacgggcgcctggcgccacatgagcgcgaggcggcgggtatccgtgacagcctgatc
cgtgttgcggtgggccttgaagacgttgccgacttgcaggctgacctggctcgcgggctg
gcggccttgtga

DBGET integrated database retrieval system