KEGG   Pseudomonas trivialis: AA957_27795Help
Entry
AA957_27795       CDS       T04006                                 

Definition
(GenBank) glutathione metabolism protein
Organism
ptv  Pseudomonas trivialis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAPEG DUF883
Motif
Other DBs
NCBI-ProteinID: AKS09761
UniProt: A0A0H5AF73
LinkDB All DBs
Position
6097940..6098362
Genome map
AA seq 140 aa AA seqDB search
MNELLQVYALCVLVLCLKMFAISCYQGFFRIRGFAFTNREDAAFFNRAVHSEEVPQVARA
AKAWANDLENIPLFFVLGGLCVALGASSFPTVCLFAGFTLARMVHTVTYLAQWQPWRTLA
YGVGVACLFGLGGMLVTKLI
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagcttttgcaggtctacgcgctgtgtgtgctggtgctgtgcctgaagatgttt
gcgatttcctgctaccagggttttttccggatacggggtttcgcatttaccaatcgtgag
gatgcggcgttcttcaatcgagccgtgcattcagaggaagtgccgcaagtcgccagggcg
gccaaggcatgggcgaatgacctggagaatatccccctgttttttgtgttgggaggactg
tgcgtggcgctgggggcgtccagtttccctacagtctgcttattcgccgggtttacgctg
gcgcggatggtgcacacggtgacgtatctggcgcagtggcaaccttggcgcacgttggcc
tatggggtcggcgtggcgtgtctctttggactgggcggcatgctggtgaccaagttgata
tga

DBGET integrated database retrieval system