KEGG   Pseudomonas trivialis: AA957_28075Help
Entry
AA957_28075       CDS       T04006                                 

Definition
(GenBank) cystathionine beta-lyase
  KO
K01758  cystathionine gamma-lyase [EC:4.4.1.1]
Organism
ptv  Pseudomonas trivialis
Pathway
ptv00260  Glycine, serine and threonine metabolism
ptv00270  Cysteine and methionine metabolism
ptv00450  Selenocompound metabolism
ptv01100  Metabolic pathways
ptv01110  Biosynthesis of secondary metabolites
ptv01130  Biosynthesis of antibiotics
ptv01230  Biosynthesis of amino acids
Module
ptv_M00338  Cysteine biosynthesis, homocysteine + serine => cysteine
Brite
KEGG Orthology (KO) [BR:ptv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AA957_28075
   00270 Cysteine and methionine metabolism
    AA957_28075
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AA957_28075
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptv04147]
    AA957_28075
Enzymes [BR:ptv01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     AA957_28075
Exosome [BR:ptv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AA957_28075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKS09811
UniProt: A0A0H5AFD4
LinkDB All DBs
Position
complement(6165184..6166350)
Genome map
AA seq 388 aa AA seqDB search
MSQPDKSAFATRVIHAGQFPDPTTGALMPPIYANSTYLQDSPGVHKGFDYGRSHNPTRFA
LERCVADLEGGSQAFAFASGLAAISTVLELLDAGAHIVSGNDLYGGTFRLFDKVRQRSAG
HRFSFVDLSDVSAFEASLQDDTRMVWVETPSNPLLSLTDLSAIARICRDRGIICVADNTF
ASPWIQRPLELGFDVVVHSTTKYLNGHSDVIGGIAIVGDNPELAERLGFLQNSVGAIAGP
FDAFLTLRGVKTLALRMERHCSNALDLATWLEQQPHVSRVYYPGLASHPQHELARKQMRG
FGGMISIDLNSDLAGATRFLENVKIFALAESLGGVESLIEHPAIMTHASIPAATRAQLGI
GDGLVRLSVGVEDVEDLRADLAQALAKI
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagcctgataaaagcgcatttgccacccgagtgatccacgccgggcaattcccc
gacccgaccacgggcgcgctgatgccgccgatctacgccaattccacctacctgcaagac
agccccggcgtgcacaagggcttcgactacggccgctcgcacaacccgacgcggttcgcc
ctggagcgctgcgtggcggacctggaaggtggcagccaggcatttgccttcgcgtccggg
ctggcggcgatttcgacggtgctggaattattggatgccggtgcccacatcgtgtccggc
aacgacctgtacggcggcactttccgcctgttcgacaaggtgcgccaacgcagcgccggg
caccgcttcagctttgtcgacctgagtgacgtgtcggcattcgaagcgagcttgcaagac
gacacgcgcatggtctgggtcgaaaccccgagcaatccactgctgagcctcactgatctg
agcgctatcgcgcgtatctgccgcgatcgcgggatcatctgcgtggccgacaataccttc
gccagcccatggatccagcgcccgctggagctgggttttgatgtcgtcgtgcattccacc
accaaatacctcaacggtcactccgatgtcattggcggcattgccattgtcggcgacaac
cccgagctggctgaacgcctgggcttcctgcagaactcggtcggcgccatcgccggtcct
ttcgatgccttcctgacgctgcgcggcgtgaaaaccctggcactgcgcatggagcgccat
tgcagcaacgccttggacctggccacctggctggagcagcaaccgcacgtttcgcgggtg
tactacccgggcctggcgtcccatccgcagcatgagctggcacgcaaacagatgcgtggg
tttggcgggatgatttcgattgacctgaacagcgacctggccggcgctacgcgcttcctg
gaaaacgtgaagatcttcgccctggcagagagcctcggcggtgtggaaagcctgatcgaa
cacccggcaatcatgacccatgcgagcattccggccgcgacgcgggcgcagctggggatt
ggcgatgggttggtgcggttgtcggtgggggtcgaggatgtagaggatctgcgcgcggat
ttggcgcaggccctggcaaaaatctaa

DBGET integrated database retrieval system