KEGG   Pseudomonas trivialis: AA957_29050Help
Entry
AA957_29050       CDS       T04006                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ptv  Pseudomonas trivialis
Brite
KEGG Orthology (KO) [BR:ptv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AA957_29050
Enzymes [BR:ptv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AA957_29050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored DAO AlaDh_PNT_C FAD_binding_3 Thi4 Glutaredoxin NAD_binding_8 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AKS09990
UniProt: A0A0H5AJU9
LinkDB All DBs
Position
6362799..6364364
Genome map
AA seq 521 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLALLQDVVSLTTLITLKTDGDDAR
KPSFSINRPGAEISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQIRALKGEFSF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVDERQVMAVPSVYLNGVNF
GQGRMGLEEILAKLDTSGIEKAAEKISAKDAFDVLVVGGGPAGSAAAIYAARKGIRTGVA
AERFGGQVLDTMSIENFISVQETEGPKLASALEAHVRQYDVDIMNLQRASSLIPAKNAGD
LHEIRFESGATLKSKTVILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSKLRADAVLQRKLYSLPNVDVITSALTSEVKGDG
QKVTGLAYKDRDSGEFKTIDLEGIFVQIGLLPNTDWLKGTVELTPRGEIIVDARGETSLP
GVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagctcagttgaagtcatacctggagcgggtcacccagccg
atcgagatcgttgcctctctcgacgacggtgcgaaatcccaggaaatgcttgctcttttg
caggacgtggtcagcctcaccacgctgattaccctgaaaaccgatggcgatgatgcgcgt
aagccctcgttctccatcaaccgcccgggtgccgagatcagcctgcgtttcgccggtatc
cccatgggtcatgaattcacttcgttggtgttggccctgctgcaagtcggtggccacccg
tcgaaggccagtgtcgaagtgattgagcagattcgcgcccttaaaggcgagttcagcttc
gagacgtacttctcgctgtcgtgccagaactgcccggacgtggtccaggcgctgaacctg
atggccgtgctcaacccgaacatccgccacgtcgccatcgacggcgcgctgttccaggct
gaagtcgacgaacgccaagtgatggcagtgccgagcgtgtacctcaatggtgtgaacttc
gggcagggccgcatgggcctggaagaaatcctcgccaagctcgacaccagcggtatcgaa
aaagccgccgagaaaatcagcgccaaagacgcctttgacgtcctcgtcgtcggcggtggc
ccagccggttctgcggctgcgatctacgccgcacgtaaaggcattcgtaccggtgtggct
gccgagcgttttggcgggcaagtgctggacaccatgtccatcgagaactttatctcggta
caggaaaccgaaggcccgaaactggccagcgccctggaagcccacgtacgtcagtacgac
gtcgatatcatgaacctgcagcgtgccagcagcctgatcccagcgaaaaacgccggtgac
ttgcacgaaattcgtttcgaaagcggtgcgaccctcaagtccaaaaccgtgatcctggcc
accggtgcccgctggcgcgaaatgggtgtgccgggcgagcaggaatacaaggcaaagggc
gtgtgtttctgcccgcactgcgatggcccgctgttcaagggcaagcgtgtggcagtgatc
ggcggcggtaactccggtgttgaagccgccatcgacctggccggcatcgtcagccacgtc
accttgcttgagttcgacagcaagttgcgcgccgacgctgtgttgcagcgcaagctgtac
agcctgccgaacgttgacgtgatcaccagcgcactgaccagtgaagtgaaaggcgatggc
cagaaagtcaccggcttggcgtacaaggatcgtgacagcggcgagttcaagactatcgac
ctcgaaggcatcttcgtgcagatcggtttgctgcccaacaccgattggctcaaaggcact
gtcgagctgacgcctcgcggcgagatcattgtcgatgcgcgtggcgagacttcattgcca
ggtgtgtttgctgccggcgacgtaacgactgtgccgtacaagcagatcgtgatcgcagtg
ggcgagggcgccaaagcttcactgagtgcgttcgatcacttgatccgtacttccgcgccg
gcgtaa

DBGET integrated database retrieval system