KEGG   Pandoraea thiooxydans: ABW99_00740Help
Entry
ABW99_00740       CDS       T03947                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
ptx  Pandoraea thiooxydans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AKJ66975
UniProt: A0A0G3EJ84
LinkDB All DBs
Position
953517..955028
Genome map
AA seq 503 aa AA seqDB search
MSTLASVSSFPFDTVSELSADVRSRFYIDGRWMAPDAAGSVDVVAPSSGQLFATAALASA
SDIDRAVDAARRAFDTGPWPNMSGAERAACMKRMSAALASRMGLLSRLWTAEVGAPVWFS
NQFAPTAVAMLDYYAELASTFAFEERRKTRAGHARIVRHPVGVAALIAPWNAQLPILSYK
LGAALAAGCTVVVKAPPETPFDALVVAECAHEAGLPPGVLNVITADAQGGAHLVGKREVD
KVSFTGSTATGKLIAKTCADRLTRVTLELGGKSAAVVLDDAVLEPTLAALAPFTMPFSGQ
ICFAQTRILVPRQRERAFVDAYSAIANGLTVGDPWDVTTQIGPVASRRQLERVLEYIETG
RREGARVTAGGGRHDQRGEGFFVQPTVFAGVTPDMTIAREEIFGPVVSIIAYDDVEQAIA
IANDTDFGLSGTVFTADAEVGYAVARRIKSGNVSVNGLEMAPNVPFGGFKQSGVGREGGP
EGLCAFLEEQAIYLAVDAGLQAG
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtctacccttgcttccgtttcgtcgtttccattcgatacggtatctgaactgagcgcc
gacgtgcgctcccgtttttatatcgacggccgctggatggcgccggatgctgccggctcg
gtcgatgttgtcgcgccgtcgagtggacagttgtttgccacggcggcgctcgcaagcgcc
tcggacatcgaccgtgcggtcgacgcggcaaggcgcgcgttcgataccggcccatggcca
aacatgtccggcgccgagcgcgccgcctgcatgaagcgaatgtcggccgctctggcatcc
cgtatgggcctactatcgcggctatggactgccgaagtcggcgcgcccgtctggttttcg
aatcagttcgcgccgactgcggtggcaatgctcgactactacgccgaactcgcgtccacg
ttcgcgtttgaggagcgtcggaagacgcgagcgggtcatgcgcggatcgtccgtcatccg
gtcggcgtcgccgcgctaatcgcgccgtggaacgcgcagcttccgattctttcatacaaa
ctcggtgccgcgctcgccgcgggctgcacggtcgtcgtgaaagcgcctcccgagacacca
ttcgatgcgctcgtcgttgccgaatgcgcacatgaggccggtctgcctccgggcgtacta
aacgtgatcacggccgatgcgcaaggcggcgcgcacttggttgggaagcgcgaagtcgac
aaagtgagcttcaccggcagcacggcaacgggcaagcttatcgcgaagacctgtgcggac
cgtctcacgcgtgtgacgctcgaacttggcggaaagtcggcagcggtcgtgctcgacgat
gccgtgctggaaccgacgctcgctgcgctggcgccattcaccatgccgttctcgggacag
atctgcttcgcgcagacgcgaatcctggtaccacggcaacgcgagcgggccttcgtcgac
gcttacagcgctatagctaacggattgacggtgggcgacccgtgggacgtaaccacacag
atcgggccggtggcgagccggcggcagctcgaacgcgtcctcgaatacatcgaaacggga
cgccgcgagggcgcgcgcgtgaccgcgggcggcggtcgccacgaccaacggggcgaaggc
ttcttcgtacaacccacggtcttcgccggcgtcacgccagacatgacgatcgcccgtgag
gagattttcggaccggtggtgtcgatcatcgcgtacgacgacgtcgaacaagcaatagcg
atcgccaacgataccgacttcggtctgagtggcactgtgttcacggccgatgccgaggtc
ggttacgccgtggcacgccggatcaaatccgggaacgtctcggtcaacggccttgagatg
gcgccgaacgtgccgttcggcggcttcaaacagtcaggtgtcggaagagagggcggcccc
gaagggctttgcgcattcctcgaggagcaggcgatctatctagccgtcgatgccggcttg
caggcggggtga

DBGET integrated database retrieval system