KEGG   Pandoraea thiooxydans: ABW99_01995Help
Entry
ABW99_01995       CDS       T03947                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ptx  Pandoraea thiooxydans
Pathway
ptx00620  Pyruvate metabolism
ptx00680  Methane metabolism
ptx01100  Metabolic pathways
ptx01120  Microbial metabolism in diverse environments
ptx01200  Carbon metabolism
Module
ptx_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ptx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABW99_01995
  Energy metabolism
   00680 Methane metabolism
    ABW99_01995
Enzymes [BR:ptx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ABW99_01995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKJ67183
UniProt: A0A0G3EJH0
LinkDB All DBs
Position
complement(1229793..1232639)
Genome map
AA seq 948 aa AA seqDB search
MDSSASAGDTKQRATRRTREDKDAPLKEDIRLLGRLLGDVLREQQGDATFELVERIRQKA
VRFHREDDRAAAEALDAILNGLTPEQTMAVVRAFSYFSHLANIAEDRHHNRRRRVHALAG
SRPQAGSLAHALATWSASQPGGNQALQAFFASALIVPVLTAHPTEVQRKSILDAERDIAR
LLASLDQPLTARERSHSLSLMRAKVTSLWQTRMLRGARLTVADEIENALSYYRTTFLSEI
PALYGDVEELLKQSAPDIPASTLAPFLQMGSWIGGDRDGNPNVTAPTLQLAITRQATEIF
NYYLDQVHALGAELSVSNLLAGASDALKTLAERSPDDSPHRADEPYRRALIGIYARLAAT
AHALLGYQAPRVAVGPAPVYADAREFASDLQTIVASLTSQHGAALIAPRLGPLVRAVEVF
GFHLASIDLRQSSDVHEAVIAELLAKAGVEKDYAKLSEDEKLALLLRELAQPRPLFSPHI
EYSQRVRGELAVFEAAREIRARFGGRAVRNYIISHTETVSDLIEVMLLQKETGLWHGQLG
NTAHPAAMNLMVIPLFETIADLRNAADIMRALLELPGFSAIVAHQGGEQEVMLGYSDSNK
DGGFLTSNWELYKAELALVNLFREKHIRLRLFHGRGGTVGRGGGPTYQAILAQPPGTVNG
HIRLTEQGEVIASKFANPEIGRRNLETIVAATLEATLLPNRNQPARLATFEKVMQTLSDE
AFAAYRALVYETPGFKDYFFAATPIAEIAELNIGSRPASRKFNDPNHRRIEDLRAIPWGF
SWGQCRLLLTGWFGFGSAVQAYLDASKDDTERARRLSLLQQMYKRWPFFANLLSNMDMVL
AKTDLAVASRYAELVPDAELRTTVFSRIVQEWESTAHALSLITGQAQRLADNPLLARSIK
NRFPYLDPLNHLQVELLRRHRSGTSDERVRRGIHLTINGIAAGLRNTG
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atggacagtagcgcatcggcaggagacacgaaacagcgcgcaacgcggcgcacacgcgaa
gacaaggacgccccgctcaaggaagacattcgcctcttgggtcgcctgctcggcgacgtg
ctgcgcgaacagcagggcgacgcgactttcgagctggtcgagcggattcgccagaaggcc
gtgcgctttcaccgcgaggatgaccgggcggccgccgaggcgctcgatgcgattctcaat
ggtctgacccccgagcagaccatggcggtggtgcgcgccttcagctatttttcgcacctg
gccaacatcgccgaagatcgccatcacaatcggcgccgtcgcgtccacgcgctggcgggc
tcccgtccgcaagccggcagcctggctcacgcgctggccacctggagcgccagccagccc
ggaggcaatcaggcgctgcaggcgtttttcgccagcgccctgatcgtgccggtcctgacc
gcgcacccgaccgaggtgcagcgcaagagtattctcgatgcggagcgcgatatcgcacga
ctgctggcctcgctcgaccagccgctgaccgcgcgtgagcgctcgcactccctgagcctg
atgcgcgccaaggtcacctcgctgtggcaaacccgcatgctgcgcggcgcccgcctgacc
gtggccgacgaaatcgaaaatgcgctgtcgtactaccgcacgacattcctgagtgaaatc
ccggcgctgtacggcgacgtcgaggaactgctcaagcagtccgctcccgacattccggcc
tccaccctggcgccgttcctgcaaatgggcagttggatcggcggcgaccgcgacggcaat
ccgaacgtgaccgccccgaccctgcagttggccatcacccggcaggccaccgaaattttc
aattactacctggatcaggtgcacgcgctgggggccgaactgtcggtgtcgaacctgctg
gccggcgccagcgacgccctcaagacactggccgagcgctcgccggacgattcgccgcat
cgcgccgacgagccgtatcggcgcgcccttatcggcatctacgcacgcctggccgcgacg
gcccacgcgctgctcggctaccaggcgccgcgcgtggcggtcggtccggcgccggtctat
gccgatgcacgagaattcgccagtgacttgcagaccatcgtggcatcgctgaccagtcaa
cacggcgccgccctcatcgcaccacgcctggggccgctggtccgggcggtcgaggtgttc
ggctttcacctggcgagcatcgatctgcgccagagttccgacgtgcacgaggccgtcatt
gcggagttgctggccaaggccggcgtggaaaaagactacgccaagttgtccgaagatgaa
aaacttgccctgctgctgcgcgagctcgcgcagccgcgtccgcttttctccccgcatatc
gagtattcgcagcgcgtgcgaggcgagctggcggtattcgaggccgcacgcgagattcgc
gcgcgcttcggcgggcgtgccgtgcgcaactacatcatttcgcacaccgagacggtcagc
gacctgatcgaagtcatgctgctgcagaaggaaaccggattgtggcatggccaactcggc
aacaccgcgcatccggccgcgatgaatctgatggtgatcccgctgttcgaaaccatcgcc
gacttgcgcaatgccgccgacatcatgcgcgccttgctggagttgcccggcttttcggcc
atcgtcgcgcaccagggcggagaacaggaggtgatgctcggttactccgacagcaacaag
gacggcggcttcctgacgtcgaactgggaactctacaaggccgaactggcgctggtgaac
ctgttccgcgagaagcacattcgcctgcggctgttccatggccgcggcggcacggtcgga
cgcggcggcggccccacctatcaagccatcctggcgcagccgccgggtaccgtcaacggc
cacatccgtctgaccgagcagggcgaagtaatcgccagcaagttcgccaacccggaaatc
ggccggcgcaatctcgagaccatcgtcgctgccacgctcgaggccacgctactgcccaac
cgcaatcagccggcgcggctggccaccttcgaaaaagtcatgcagaccctgtcggacgag
gcgttcgcggcttaccgcgcgctggtctacgagactcctggcttcaaggattattttttc
gccgcgacgccgattgccgaaatcgccgagctcaatatcggctctcgtccggcctcgcgc
aaattcaatgatccgaaccatcgccgcatcgaagacctgcgagcgattccatggggtttc
tcgtggggtcaatgccgcttgctgttgaccggctggttcggcttcggcagcgccgtgcag
gcttacctggacgccagcaaggacgacaccgagcgcgccaggcgcctgtcgttattgcag
cagatgtacaagcgctggccgtttttcgccaacctgctgtccaatatggacatggtgctg
gccaaaaccgatctggcggttgcctcccgctatgccgaactggtacccgacgccgaattg
cgcactacggttttcagccggatcgtgcaggaatgggaaagcaccgcccacgcgctgtcg
ctgatcaccggccaggcgcaacggctggccgacaatccgctgctggcgcgctcgatcaag
aatcgcttcccctatctcgatccgctcaatcacctgcaggtcgaactgctgcggcggcat
cgctccggcaccagcgacgaacgcgtgcggcgcggcatccacctgactatcaacggcatt
gccgcgggcctgcgcaacacaggctaa

DBGET integrated database retrieval system