KEGG   Pandoraea thiooxydans: ABW99_02270Help
Entry
ABW99_02270       CDS       T03947                                 

Definition
(GenBank) D-amino-acid oxidase
  KO
K21061  D-hydroxyproline dehydrogenase subunit beta [EC:1.5.99.-]
Organism
ptx  Pandoraea thiooxydans
Pathway
ptx00330  Arginine and proline metabolism
ptx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    ABW99_02270
Enzymes [BR:ptx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.-  
     ABW99_02270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Pyr_redox_2 FAD_binding_2 Thi4 NAD_binding_9 FAD_binding_3 HI0933_like FAD_oxidored Pyr_redox 3HCDH_N NAD_binding_2 ApbA Lycopene_cycl UDPG_MGDP_dh_N TrkA_N Pyr_redox_3 F420_oxidored 2-Hacid_dh_C LrgB NAD_binding_7 XdhC_C
Motif
Other DBs
NCBI-ProteinID: AKJ67229
UniProt: A0A0G3EMJ4
LinkDB All DBs
Position
complement(1295102..1296244)
Genome map
AA seq 380 aa AA seqDB search
MNTPVPDVAIVGAGIVGAACAHELAARGLHVMVIDRAGVGTGTTAAGMGHLVVMDDSPAE
FALSAYSRALWLALAPRLEARHAFVKCGTLWVAADDEELALAQTRQQALEAQGIACHMLD
ADQVREAEPELRDGLAGGMVVPDDAVVYAPTVAAWLLAQPVAGRIDTRLASEVVALERDG
VRLADGSSIAAGAVLLANGIQAPELLPGLPLQAKKGHLLITDRYPGMVHHQILELGYIKS
AHHQSGTSVAFNVQPRPTGQLLIGSSRQFDSLDAAIDQAVLARMLRRAAEYLPNLPALQA
IRAWTGFRPASSDGLPLIGPAALDTPHPATWLALGHEGLGVTTALGTARLIAAQMLRTQA
PLDAAPYLPARFARPGVAHG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcctgtacccgatgtcgcgatcgtcggcgccggcatcgtcggcgccgcgtgc
gcccacgagctggccgcgcgcgggctgcacgtgatggtgatcgaccgtgccggcgtcggc
accggcaccaccgcggccggcatgggtcatttggtcgtgatggacgactcgcccgcggag
ttcgcgctcagcgcctattcgcgcgcgctctggctggcgctcgcgccgcgcctggaggcc
cgtcatgcgttcgtcaaatgcggcacgctatgggtcgccgccgacgacgaggagctcgcg
ctggcgcaaacccgccagcaggcgctcgaggcccagggcattgcctgccacatgctcgac
gccgaccaggtgcgcgaggccgaaccggaattgcgcgacggcctggccggcggcatggtg
gtgcccgacgacgccgtggtctatgcgccgacggtggccgcctggctgctcgcgcaaccg
gtcgcaggccgtatcgacacgcggctcgccagcgaggtcgtcgcgctcgagcgcgacggc
gttcggctggccgacggcagcagcattgccgccggcgccgtgctgctggccaatggcatc
caggcgcccgagctgcttccgggcctgccgctgcaggcgaaaaagggacatctgctgatc
accgaccgctaccccggcatggtgcaccaccaaatcctcgaactcggctacatcaagagc
gcccatcatcagagcggcacttcggtcgcctttaacgtacagccgcgcccgaccggccag
ttgctgatcggctcgtcgcgccagttcgatagcctcgatgcggcgatcgatcaagcggtc
ctggcgcgcatgctgcggcgcgccgccgaatacctgccgaatctcccggcgctgcaggcg
attcgcgcctggacagggtttcgcccagcctccagcgacggcctgccgctgatcggcccg
gccgcgctcgatacgccacatcccgcgacctggctcgcgctcggccacgaaggactgggt
gtcaccacggcgctgggcaccgcccgattgattgccgcccagatgctgcgcacgcaggcg
ccgctggacgccgcgccttacctgccggcgcgcttcgctcgcccgggagtcgctcatggc
tga

DBGET integrated database retrieval system