KEGG   Pandoraea thiooxydans: ABW99_08300Help
Entry
ABW99_08300       CDS       T03947                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ptx  Pandoraea thiooxydans
Pathway
ptx00061  Fatty acid biosynthesis
ptx00780  Biotin metabolism
ptx01100  Metabolic pathways
ptx01212  Fatty acid metabolism
Module
ptx_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ptx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ABW99_08300
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ABW99_08300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ptx01004]
    ABW99_08300
Enzymes [BR:ptx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     ABW99_08300
Lipid biosynthesis proteins [BR:ptx01004]
 Fatty acid synthase
  Component type
   ABW99_08300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AKJ68209
UniProt: A0A0G3EQA2
LinkDB All DBs
Position
complement(2601773..2602237)
Genome map
AA seq 154 aa AA seqDB search
MNQNTVKIDIHQILKLLPHRYPMLLVDRVIELEPHKSITAIKNVTINEPFFTGHYPQRPV
MPGVLIIEALAQTAALLTFSEDTEHGEDSLYYFVGIDGARFKRPVEPGDQMVLHVDFERF
LRGIWKFKGRAMVDGVVAAEAEFMCMIKKNPEAN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagaacaccgtcaaaatcgatattcaccagattctcaagctgctgccgcaccgc
tatccgatgctgttggtcgatcgcgtcatcgagctcgagccgcacaagagcattacggcg
atcaagaacgtgaccatcaacgagccattctttaccggtcactacccgcagcggcctgtc
atgcccggcgtgctgatcatcgaggccttggcgcagaccgcggctttgctgacgttctcc
gaagataccgagcatggcgaggactcactgtactacttcgtcggcatcgatggcgcgcgc
ttcaagcgacccgttgagccgggcgatcaaatggtgctccatgtcgacttcgagcgcttt
ttgcgcggcatctggaagttcaaggggcgggcaatggtcgacggcgtcgttgccgcggaa
gccgagttcatgtgcatgatcaagaagaaccctgaagccaactga

DBGET integrated database retrieval system