KEGG   Pandoraea thiooxydans: ABW99_11845Help
Entry
ABW99_11845       CDS       T03947                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
ptx  Pandoraea thiooxydans
Pathway
ptx00030  Pentose phosphate pathway
ptx01100  Metabolic pathways
ptx01110  Biosynthesis of secondary metabolites
ptx01120  Microbial metabolism in diverse environments
ptx01130  Biosynthesis of antibiotics
ptx01200  Carbon metabolism
ptx01230  Biosynthesis of amino acids
Module
ptx_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ptx_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ptx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ABW99_11845
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    ABW99_11845
Enzymes [BR:ptx01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     ABW99_11845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AKJ68807
UniProt: A0A0G3ETW1
LinkDB All DBs
Position
complement(3384252..3386231)
Genome map
AA seq 659 aa AA seqDB search
MSHTDAKALANAIRFLSIDAILQAGEGHQGVPLGMAEIATALFTRHLKFNPADPAWADRD
RFVLSNGHGSMLLYSLLYLTGYKRIGLDQIQSFRELGSHCAGHPEFDTGAGIEVTTGPLG
QGIANAMGMAIAEAYLAARFGRGIVDHYTYAFVGDGCLQEGIGQEMISLAGHLRLGKLIL
CWDDNRITDDGSTELSISEDVAARFRVAGWHVQEVDGHDLEAVSAALDNARQDPRPSLLA
CRTVIARGIARLQGQRGGHSGRLFADDARQMRDALDWPHAPFEMPGPVLDAWRAAGRRSQ
GEYDAWRERVAALAPAERAEFERIQAGQLPEGWRDVLEDYRRRAMQSDEAQAGIMISADI
NDLLTPHLPERMVGCADLEAPTGHKRQLRAFAAGERAGAYVHCGVREHLMGAMANGMAAH
GGVIALAVTYLAFSDYERPAMRMAALMGLPVKFVFSHDSIGVGKNGPTHQPVEILASLRA
MPNMLVMRPADAVEAAECWMVALEHRTGPSTLVFARQGLPRVRAEHVEENLSRRGAYVLA
EAEGGARQVTLLATGSEVAVALAARARLQGQGVPSAVVSMPCWALFEAQDADYRAAVLGP
GTVRVGIEAAVRLGWDRYLGERGAFVGMTGFGASGPGEALYEHFGITAEQVASQAMRLL
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacaccgatgccaaggcgttggccaacgcaatacgctttctgtccatcgacgcc
attctgcaagccggcgaagggcatcagggcgtgccgctgggcatggccgagatcgccacg
gcgctcttcacgcgccatctcaaattcaatccggccgacccggcctgggccgaccgcgat
cgcttcgtgctctccaacgggcacggctcgatgctgctgtactcgctgctttatttgact
ggctacaagcgtatcggactcgatcagatccagtcgttccgggagctcggctcgcattgc
gccggacatccggaattcgacaccggcgccggtatcgaagtcaccaccgggccgctcggg
cagggcattgccaatgcgatgggcatggcgattgccgaggcctacctggcggcccgcttc
ggccgcggcattgtcgaccactacacctacgcgttcgtcggcgacggctgcctgcaggaa
ggcatcggccaggagatgatctcgctggccgggcacctgcgcctgggcaagctgatcctg
tgctgggacgacaaccggatcaccgacgacggcagcaccgaactgtcgatcagcgaagat
gtcgcggcgcgctttcgcgtggccggctggcatgtgcaggaagtcgacgggcacgacctc
gaagcggtgtcggccgcgctggacaacgcgcgccaggacccgcgcccgtcgctgctggcg
tgccgcaccgtcatcgcgcgcggcatcgcgcgcctgcagggccagcgcggcggccacagc
gggcgcctgttcgccgacgacgcccggcagatgcgcgacgcgctggattggccgcatgca
ccgttcgagatgccgggcccggtgctcgacgcctggcgcgccgccgggcgccgcagccag
ggtgaatacgatgcctggcgcgagcgcgtggccgcgctggcgccggccgagcgcgccgag
ttcgagcgcattcaggctggccagctgcccgagggctggcgcgacgtgctcgaagactat
cgccggcgcgcgatgcaaagcgacgaggcccaggccggcatcatgatctcggccgacatc
aacgacttgctcacaccgcatctgccggagcgcatggtcggttgcgccgacctggaagcg
cccaccggacacaagcggcaactgcgcgcgtttgcggccggcgagcgcgccggcgcttat
gtgcactgcggcgtgcgcgagcatctgatgggggcgatggccaacggcatggccgcgcat
ggcggcgtgattgcgctggccgtcacctatctggcgttttccgactacgagcggccggcg
atgcgcatggccgcgctgatgggcttgccggtcaaattcgtcttcagccacgactcgatc
ggggtgggcaagaacggcccgacccatcagccggtcgagatcctggcctcgttgcgggcg
atgccgaacatgctggtgatgcgcccggccgacgcggtcgaggccgccgagtgctggatg
gtcgcgctcgagcatcgcaccggcccgagcacgctggtgttcgcccgtcagggcctgccg
cgggtgcgcgccgaacacgtcgaggaaaacctctcgcgccgcggcgcatatgtgctggcc
gaagccgaaggcggcgcgcggcaagtcaccttgctggccaccggctcggaagtcgccgtg
gcgctggccgcccgtgcgcggctgcagggccagggcgtgccgagcgccgtggtgtcgatg
ccgtgctgggcgctgttcgaggcgcaggacgccgattaccgcgccgccgtgctcgggccc
ggcaccgtgcgcgtgggcatcgaagcagcggtgcggctcggctgggaccgctatctcggc
gagcgcggcgccttcgtcggcatgaccggcttcggcgcctccgggcccggcgaggcgctt
tacgaacacttcggcatcactgccgagcaggtcgcatcgcaagcaatgcggctcctttga

DBGET integrated database retrieval system