KEGG   Pandoraea thiooxydans: ABW99_13390Help
Entry
ABW99_13390       CDS       T03947                                 

Definition
(GenBank) mechanosensitive ion channel protein MscS
  KO
K16053  miniconductance mechanosensitive channel
Organism
ptx  Pandoraea thiooxydans
Brite
KEGG Orthology (KO) [BR:ptx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ptx02000]
    ABW99_13390
Transporters [BR:ptx02000]
 Other Transporters
  Pores ion channels [TC:1]
   ABW99_13390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MS_channel MHB
Motif
Other DBs
NCBI-ProteinID: AKJ69052
UniProt: A0A0G3EUP3
LinkDB All DBs
Position
complement(3727016..3728293)
Genome map
AA seq 425 aa AA seqDB search
MGVAWMWLNAIEHFWADPLARMGSSLTLLVLVAYFLYWISHRLLLRAMRVVVLRTSWRWD
DTMLDAGVFQRLAQMVPFLVIQGGIDLVPDVPARVDQIIRNVALSGAVLFGMLALSAALS
ALQVAYAATPHARTRSIKGYVQLGKIAVFVFGGVAIIATLVDRSPWLLLSGLGAMSAVLL
LVFKDTLLSLVASVLLTSNDMLRVGDWIEMPQVGADGDVIDIALHTVKVQNWDKTITTIP
TWRLISESFRNWRGMQLAGGRRIKRTLRIDTASVHFLDEAAVARLAALRLLTPYLEKKRE
ELEAANRSLGDSAQFAANRRRLTNIGTFRAYMSAYLQAHPDVHQEMTCMVRSLEPDANGI
PIEIYCFTRTIVWGDYERIQGDIFDHLLAILPEFGLRLYQNLGGADMRLTWMQGEANSSV
SARAA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atcggagttgcctggatgtggttgaatgccattgagcatttttgggccgacccgctggcc
cgtatgggctccagtctgacgttactcgttctggtggcgtatttcctttactggatttcg
catcggttgttgctgcgcgcgatgcgggtggtcgtactgcgcacctcctggcgatgggac
gacaccatgctcgacgccggcgtgttccagcgcctggcgcagatggtgccgtttctcgtt
atccagggcggcatcgatctcgtgcctgatgttccggcgcgcgtcgaccagatcattcgc
aacgttgcgctctccggtgccgtgctgttcggcatgctcgcgctcagtgctgcgctgagc
gctctgcaagttgcctacgcggcaacacctcacgcccgcacgcgctcgatcaagggctac
gtgcaactgggcaaaatcgccgtcttcgtgttcggtggcgtcgcgattatcgcgacgctg
gtcgatcgctcgccgtggcttttgctgtccgggctgggcgcgatgtcggcggtgctgctg
ctggtgttcaaggacacactgctgtcgctggtcgcgagcgtgctgctgacctccaacgat
atgctgcgcgtgggggactggatagaaatgcctcaggtcggcgccgacggcgatgtcatc
gatattgcgctgcataccgtcaaagtgcagaactgggacaagaccatcacgacgattccc
acctggcgcctgatttccgaaagcttccgcaattggcgcggcatgcagctggccggtggg
cgccgcatcaagcgcaccttgcggatcgatacggccagcgtccattttcttgacgaggcc
gccgtcgcgcggctggcggcgctgcgtttgctcacgccttatctcgagaaaaagcgcgaa
gagctcgaggccgccaatcgcagcctgggcgatagcgcgcaattcgccgcgaaccgtcga
cgtctgaccaacatcgggacattcagagcgtacatgagcgcctatctgcaggcccacccg
gacgtgcaccaggagatgacctgcatggtgcgatccctcgagcccgacgccaacggcatc
ccgatcgaaatttattgtttcacgcgcaccatcgtttggggcgactacgagcgtattcag
ggcgacatcttcgatcacctcctggcgatcctgcccgaattcggcttgcgcctgtatcag
aatctggggggcgccgatatgcgcctgacctggatgcaaggcgaagcgaattcgtcggtg
tcggcgcgggctgcctga

DBGET integrated database retrieval system