KEGG   Pandoraea thiooxydans: ABW99_15805Help
Entry
ABW99_15805       CDS       T03947                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ptx  Pandoraea thiooxydans
Pathway
ptx00020  Citrate cycle (TCA cycle)
ptx00480  Glutathione metabolism
ptx01100  Metabolic pathways
ptx01110  Biosynthesis of secondary metabolites
ptx01120  Microbial metabolism in diverse environments
ptx01130  Biosynthesis of antibiotics
ptx01200  Carbon metabolism
ptx01210  2-Oxocarboxylic acid metabolism
ptx01230  Biosynthesis of amino acids
Module
ptx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ptx_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ptx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABW99_15805
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ABW99_15805
Enzymes [BR:ptx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ABW99_15805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AKJ69458
UniProt: A0A0G3EQX8
LinkDB All DBs
Position
complement(4229626..4231866)
Genome map
AA seq 746 aa AA seqDB search
MSAEQSTIIYTLTDEAPLLATSAFLPIIRTFTAPAGIQVETSDISVAGRILGEFPEFLTE
EQRVPDNLAELGRLTQLPDTNIIKLPNISASVHQLVGAIKELQSKGYNVPDFPEDPKTEV
EKTIRQRYSKCLGSAVNPVLREGNSDRRAPAAVKNYARKHPHSMGEWSMASRTHVAHMKH
GDFYHGEKSMTLDRARDVKMELLTADGKTIVLKPKVALQAGEIIDSMFMSKTALCEFYEE
QMEDARKTGVMLSLHVKATMMKVSHPIVFGHAVKIFYKDAFAKHGKLFDELGVNVNNGLV
NLYDKIESLPSSKREEIIRDLHACHEHRPELAMVDSAKGISNLYAPNDVIVDASMPAMIR
IGGKMWGADGRPKDTKAVIPESTFARIYQEVINFCKTNGNFDPVTMGTVPNVGLMAQQAE
EYGSHDKTFEVPEAGEARIVDIATGEVLLVQNVEQGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAIFWLDPYRPHEAELIKKVETYLKDHDTTGLDIQIMSQVRAMRYTLERVIRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAVSLEETGIKTGNARAKLLARTLDAATGKLLENNKNPSPKTGQLDNR
GSQFYLALYWAQALAEQTEDAELAARFAPLAQQLTDNEPAIVAELSAVQGKPVDIGGYYK
PDFAKLDAVMRPSQTFNRALAAVNAA
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgagcaatccaccattatctacactctcaccgacgaagccccgctgctggcc
accagcgcctttttgccgatcattcgcacatttacggcgccggcgggcattcaggtcgag
accagcgacatttccgtggctggccgcattcttggcgagtttcccgaatttctgaccgag
gaacagcgcgtgccggacaacctggccgagctggggcggctgacgcagttgcccgacacc
aatatcatcaagctgcccaacatcagcgcttcggtgcaccagctggtcggtgcgatcaag
gaattgcagtccaagggctacaacgtgccggatttccccgaagacccgaagaccgaggtc
gagaagacgattcgccagcgctattcgaagtgtctgggcagtgccgtgaacccggtgctg
cgcgagggcaactccgatcgccgcgcgccggccgccgtaaagaattacgcacgcaagcat
ccgcacagcatgggcgagtggagcatggcctcgcgcacgcacgtcgcgcacatgaagcac
ggcgacttctatcacggcgaaaagtcgatgacgctcgaccgcgcgcgcgacgtcaagatg
gaactgctcaccgccgacggcaagaccattgtgctcaagccgaaggtcgcgctgcaggcg
ggcgagatcatcgacagcatgttcatgagcaagacggcgctgtgcgaattctatgaagag
cagatggaagacgcgcgcaagaccggcgtgatgctgtcgctgcacgtcaaggccaccatg
atgaaggtctcgcacccgatcgtgttcggccatgcggtcaagattttctacaaggacgcc
ttcgccaagcacggcaagctgttcgacgagctgggcgtgaacgtgaataacggcctggtc
aatctgtacgacaagatcgagtcgctgccgagctccaagcgcgaggaaatcatccgcgac
ctgcacgcctgccacgaacaccgccccgagctggcgatggtcgactcggccaagggcatc
tccaacctttacgcgcccaacgacgtgatcgtcgacgcctcgatgccggccatgatccgc
atcggcggcaagatgtggggcgccgacggccgcccgaaggacaccaaggcggtgattccg
gagagcaccttcgcccgcatctatcaggaagtgatcaacttctgcaagaccaacggcaac
ttcgatccggtcaccatgggcaccgtgcccaacgtcgggctgatggcgcagcaggccgag
gaatacggctcgcacgacaagacgttcgaagtgcccgaagccggcgaagcccgcatcgtc
gacatcgccaccggtgaagtgctgctggtgcaaaacgtcgagcagggcgacatctggcgc
atgtgccaggtcaaggacgcgccgattcgcgactgggtcaagctggccgtcacgcgcgcg
cgcaattccggcatgccggcgattttctggctcgacccgtaccgtccgcacgaggccgag
ctgatcaagaaggtcgagacctacctcaaggaccacgacaccaccggcctggacatccag
atcatgtcgcaggtgcgggcgatgcgctacacgctcgagcgcgtgattcgcgggctcgac
accatctcggtcaccggcaacatcctgcgcgactacctcaccgacctgttcccgatcatg
gaactcggcaccagcgccaagatgctctcgatcgttccgctgatggccggcggcggcatg
tacgagacgggcgccggcggctcggcccccaagcacgtcaagcagctggtcgaagaaaac
cacctgcgctgggattcgctgggtgaattcctcgcgctggccgtgtcgctggaggaaacc
ggcatcaagacgggcaatgcccgcgccaagctgctcgcgcgcacgctcgacgcggccacc
ggcaagctgctggaaaacaacaagaatccgtcgcccaagaccggccagctcgacaatcgc
ggcagccagttctatctggccctgtactgggcgcaggcgctggccgagcaaaccgaagac
gccgaactggcggcacgtttcgcgccgctggctcagcaactgaccgacaacgagccggcc
atcgtggccgagctctctgccgtgcagggcaagccggtcgacatcggcggctactacaag
cccgatttcgccaagctcgacgccgtgatgcgcccgagccagacgttcaaccgggcgctc
gccgcagtcaacgccgcataa

DBGET integrated database retrieval system