KEGG   Pandoraea thiooxydans: ABW99_18895Help
Entry
ABW99_18895       CDS       T03947                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ptx  Pandoraea thiooxydans
Pathway
ptx00473  D-Alanine metabolism
ptx00550  Peptidoglycan biosynthesis
ptx01100  Metabolic pathways
ptx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ptx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ABW99_18895
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ABW99_18895
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    ABW99_18895
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ptx01011]
    ABW99_18895
Enzymes [BR:ptx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ABW99_18895
Peptidoglycan biosynthesis and degradation proteins [BR:ptx01011]
 Precursor biosynthesis
  Amino acid ligase
   ABW99_18895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATP-grasp_4 CPSase_L_D2 ATPgrasp_ST TTL
Motif
Other DBs
NCBI-ProteinID: AKJ70711
UniProt: A0A0G3F106
LinkDB All DBs
Position
407829..408767
Genome map
AA seq 312 aa AA seqDB search
MGGRSAEREISLISGKGVLDALRSRGVDAHEFDTGTRSLAELAAQKFDRVFIALHGRFGE
DGTMQGALEHLGVPYTGSGVLASALAMDKEMTKRIWLHEGLSTPRFVMLKADSDWQAVGR
DLGFPLIVKPSREGSTIGLTKVTDVSQLPAAYEKAARLDGDVLAEEFIDGDELTVPVLGI
GTRGAGAARALPVIRIVAPDANYDYQNKYFTDETRYECPPALPVSLQEEVQRLVLRAYLV
LGCRGWGRADVMLRKRDNKPYLLEINTSPGMTGHSLVPMSARATGLSYEDLVLEILSTAT
LDLHPTDQWKPE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgggcgggcgctcggccgagcgtgagatctcgttgatatccggaaaaggggtgttggac
gcgttgcgctcgcgcggcgtggacgctcacgaattcgataccggcacgcgcagtctggcc
gaattggcagcccagaaattcgatcgggtattcatcgcgctgcatggccgcttcggtgaa
gacggcacgatgcaaggcgcgttggaacatctgggagtgccctacacgggcagcggcgtg
ctggcgtcggcgttggcgatggacaaggaaatgaccaagcggatctggctgcacgaaggc
ctgtcgacgcctcgcttcgtcatgctcaaggccgacagcgactggcaggcggtcgggcgt
gatctgggtttcccgctgatcgtcaaaccgtcgcgcgaaggctcgaccattggcctgacc
aaggtcacggacgtttcgcaattgccggcggcatatgagaaggcggcgcgcctggacggc
gatgtactggccgaggagttcatcgacggcgacgaattgaccgtgccggtgcttggcatc
ggcacgcgcggggcgggcgcagcgcgtgccctgccggtgattcgcatcgtcgcgcccgat
gccaattacgactaccagaacaagtactttaccgacgagacccgctacgagtgcccaccc
gcgttgccagtctcgctccaggaggaagtgcagcggctggtgctgcgcgcctaccttgtg
ctggggtgccgtggatgggggcgtgccgatgtgatgctgcgcaagcgcgacaacaaaccc
tatttactggagatcaacacatcacccggcatgaccgggcattcgctggtgccgatgtcg
gcacgagcaaccggcctgagctatgaggatctcgtgctggaaatattgagtaccgcaacc
ctggatctgcatcccaccgaccagtggaaaccggaataa

DBGET integrated database retrieval system