KEGG   Pandoraea thiooxydans: ABW99_19640Help
Entry
ABW99_19640       CDS       T03947                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ptx  Pandoraea thiooxydans
Pathway
ptx00020  Citrate cycle (TCA cycle)
ptx00480  Glutathione metabolism
ptx01100  Metabolic pathways
ptx01110  Biosynthesis of secondary metabolites
ptx01120  Microbial metabolism in diverse environments
ptx01130  Biosynthesis of antibiotics
ptx01200  Carbon metabolism
ptx01210  2-Oxocarboxylic acid metabolism
ptx01230  Biosynthesis of amino acids
Module
ptx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ptx_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ptx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABW99_19640
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ABW99_19640
Enzymes [BR:ptx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ABW99_19640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AKJ70726
UniProt: A0A0G3F114
LinkDB All DBs
Position
562286..563536
Genome map
AA seq 416 aa AA seqDB search
MYQHIKVPAGEKITVNKDFSLNVPDNPIIPYIEGDGTGFDITPVMIKVVDAAVQKAYQGK
RKISWMEIYAGEKSTKVYGPDVWLPEETLQVLKEYVVSIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYFKGVPSPVRAPEKIEMVIFRENSEDIYAGIEWEAESEQAKKVIAFLQ
NEMGVKKIRFPSTSGIGIKPVSREGTQRLVRKAIQYAIDNDRQSVTLVHKGNIMKYTEGG
FRDWGYELAQKEFGAELIDGGPWCKLKNPKTGKEITIKDSIADAFLQQILLRPAEYDVIA
TLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEILSA
EMMLRHMGWFEAADMIIASMEKSILSKKVTYDFARLMEGATQVSCSGFGQVMIDNM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtatcagcacatcaaagttccggccggggaaaaaatcacggtcaacaaggatttttcc
ctgaacgttccggacaatcccatcattccctatatcgagggcgacggtaccggattcgat
attacgccggtcatgatcaaggtggtcgacgcggccgtgcagaaggcttatcagggcaaa
cgcaagatcagctggatggaaatctacgcgggcgaaaaatcgaccaaggtatacgggccg
gatgtctggctgccggaagagaccttgcaagtgctcaaggagtacgtggtgtcgatcaag
gggccgttgacgacccccgtgggcggcggcattcgctcgttgaacgtggcgctgcgccag
gaactcgacctctacgtgtgcctgcggccagtgcgctacttcaagggtgtgccctcgccg
gtgcgcgcgccggagaagatcgaaatggtgattttccgtgagaattcggaagacatctac
gccggaatcgagtgggaagcggaatccgagcaggccaaaaaggtcatcgcttttctgcaa
aacgagatgggggtcaagaaaattcgcttcccatccacctcgggtatcggcatcaagccg
gtttccagagagggtacccaacgcctggtgcgcaaggcgatccagtacgcgatcgacaat
gatcgccagtcggtcacgctggtgcacaagggcaacatcatgaaatacaccgaaggtggg
ttccgtgactggggttacgagctggcgcaaaaggaattcggtgccgaattgatcgacggc
gggccgtggtgcaaactcaagaacccgaagacgggcaaggaaatcaccatcaaggattcg
attgccgacgcgttcctgcagcagattctgttgcgtccggcggaatacgacgtgatcgcc
acgctcaatctgaacggcgattacatctccgatgcgctggccgctcaagtcggcggcatc
gggatcgcccccggtgcgaatctgtcggactcggtggccatgtttgaagccacgcacggg
acagcccccaagtatgccggcaaggactacgtgaatccgggctccgagattctgtcggcc
gagatgatgctgcgccacatgggatggttcgaagcggccgatatgatcatcgcgtcgatg
gaaaaatcgatcctgtccaagaaggtgacctacgacttcgcccggctgatggagggggcg
acccaggtgtcgtgctccggtttcggccaggtcatgatcgacaatatgtaa

DBGET integrated database retrieval system