KEGG   Candidatus Pelagibacter ubique: SAR11_0010
Entry
SAR11_0010        CDS       T00257                                 

Gene name
thyX
Definition
(GenBank) thymidylate synthase-complementing family protein (Pfam)
  KO
K03465  thymidylate synthase (FAD) [EC:2.1.1.148]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00240  Pyrimidine metabolism
pub00670  One carbon pool by folate
pub01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pub00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAR11_0010 (thyX)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAR11_0010 (thyX)
Enzymes [BR:pub01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.148  thymidylate synthase (FAD)
     SAR11_0010 (thyX)
SSDB
Motif
Pfam: Thy1 ENT
Other DBs
NCBI-ProteinID: AAZ20835
UniProt: Q4FPM5
LinkDB
Position
complement(9267..10301)
AA seq 344 aa
MVITKFVYRRSWQANTITIKAFERDSIKIMKLTKEQSQEIKDQQGQQNQTKRVTAPALEN
ILYEAMPALDHGFVRVIDYMGDDTSIVQSARVSYGKGTKQVSTDAGLIKYLMRHWHSTPF
EMCEIKYHVKLPIFIARQWIRHRTANVNEYSARYSILDKEFYLPSAENLAAQSSSNRQGR
GDVIEGEQAKEVLELLKNDAEQTYDNYEMMLNQRFDGSTIDENKKGLARELARMNLTLNT
YTQWYWKTDLLNLMNFLRLRADSHAQYEIRVYADIMLDTVKKWVPITYDAFMDYRVGGTE
VSAKGKIIIQKLIKGEDVNPDSSGLSKREWNELMVSFDLKDKLI
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggttattacgaaattcgtttatcgtcgtagttggcaagccaacactattactataaaa
gcatttgagagagattcaataaaaatcatgaaattaactaaagaacaatcacaagagatc
aaagatcaacaaggtcagcaaaatcaaacgaaaagggttactgccccagcgcttgaaaat
attctgtatgaggcaatgccagcattagaccatggttttgtaagagttattgattacatg
ggagatgacacttcaattgttcagtcagctagagtttcgtatggaaaaggaaccaaacaa
gtttcaacagatgcaggtttaattaaatatttaatgagacattggcacagcactccattt
gaaatgtgtgaaatcaaatatcatgtgaagcttccaatttttattgctcgtcaatggata
agacatagaacagcaaatgttaatgagtactcagctaggtattcaattttagataaagaa
ttttatttgccatctgcagaaaatttagcagctcaatcttcaagcaacagacaaggtaga
ggtgatgttattgaaggtgaacaagcaaaagaagttttagaacttttaaaaaatgatgct
gaacaaacttatgacaactatgagatgatgctcaatcaaagatttgatggatcaacgatt
gatgaaaataaaaaagggttagcaagagaacttgcaagaatgaatttaactttaaacact
tatacccagtggtattggaaaactgatttattaaacttaatgaattttttaagattaaga
gctgatagtcatgctcagtatgaaataagagtttatgctgacatcatgttagatactgtt
aagaaatgggtacctataacttatgatgcgttcatggattatagagtagggggcacagaa
gtttcagctaaaggaaaaattatcattcaaaaacttattaaaggtgaggatgttaatcca
gatagttcaggcttatccaaaagagaatggaatgaacttatggtttcttttgatcttaaa
gataagttgatttaa

DBGET integrated database retrieval system