KEGG   Candidatus Pelagibacter ubique: SAR11_0021Help
Entry
SAR11_0021        CDS       T00257                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00550  Peptidoglycan biosynthesis
pub01100  Metabolic pathways
pub01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SAR11_0021 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SAR11_0021 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SAR11_0021 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pub01011]
    SAR11_0021 (ddlB)
Enzymes [BR:pub01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SAR11_0021 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:pub01011]
 Precursor biosynthesis
  Amino acid ligase
   SAR11_0021 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N RimK ATP-grasp_4 GARS_A ATP-grasp_3 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AAZ20846
UniProt: Q4FPK8
LinkDB All DBs
Position
complement(23211..24125)
Genome map
AA seq 304 aa AA seqDB search
MTKKILILSGGISKERLISLDTGKQVAKELIKNGYKVLISEPDKNLSKNITSFKPDVIFN
ALHGQFGEDGYIQAILETKKIPYTHSGVIASSIAMDKEISKKIFIKNKILTPKYIKFNHK
KNKLNIIKLIEKNLKFPVVVKPINEGSSVHVYICDKTNILKNLKVLKSYNEILIEEFIPG
REIQVAIMNNKSLGAIELEPRRKFYDYEAKYNSSAKTKHLIPVDLSKNNLAKITGIARAA
HKIIGCKGVTRSDFKFFNGKFYLLEINTQPGMTKLSLVPEIAKHKGISFIKLIEWILKDA
SINR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaaatcttaatattatctggtggtatatctaaggaaaggttaattagctta
gatactggaaagcaagttgccaaagagttaattaaaaatggatataaggttttaattagt
gagcctgataaaaatctttcaaagaatatcacttcatttaaaccagatgttatttttaat
gcgctacatggacaatttggtgaggatggatacattcaagcaattttagagactaaaaaa
attccatacacacactcaggtgtaattgcatcatcaatagcaatggataaagaaatttca
aaaaaaatttttataaaaaataaaatactaactccgaaatatattaaatttaatcataaa
aaaaataaacttaacattataaaattaattgaaaaaaatttaaaattccctgtagtagta
aaacctataaatgaagggtctagcgttcatgtatatatttgtgacaagaccaatatatta
aaaaacttaaaagtattaaaaagttataatgaaatattaattgaggaatttataccaggt
agagaaatccaagttgcaataatgaataataaatcacttggtgcaattgaacttgagcct
agaagaaagttttatgattatgaggcaaaatataattctagtgctaagactaagcactta
attcctgtagatttgagtaaaaataatcttgctaaaattactggcatagcaagagcagct
cataaaattataggttgtaaaggtgttacaagatctgactttaaattttttaatgggaag
ttttatttgttagagattaatactcagcctggaatgactaaactttcattagtccctgag
attgcaaaacataagggtataagctttataaaattaattgaatggattttaaaagatgca
tcaatcaataggtaa

DBGET integrated database retrieval system