KEGG   Candidatus Pelagibacter ubique: SAR11_0246Help
Entry
SAR11_0246        CDS       T00257                                 

Definition
(GenBank) GcvT-like Aminomethyltransferase protein
  KO
K17486  dimethylsulfoniopropionate demethylase [EC:2.1.1.269]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00920  Sulfur metabolism
pub01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pub00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SAR11_0246
Enzymes [BR:pub01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.269  dimethylsulfoniopropionate demethylase
     SAR11_0246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C CLIP_SPH_Scar
Motif
Other DBs
NCBI-ProteinID: AAZ21068
UniProt: Q4FP21
LinkDB All DBs
Structure
PDB: 

Position
complement(248657..249766)
Genome map
AA seq 369 aa AA seqDB search
MKNFSIAKSRRLRSTPYTSRIEKQGVTAYTIYNHMLLPAAFGSIEDSYKHLKEHVQIWDV
AAERQVEISGKDSAELVQLMTCRDLSKSKIGRCYYCPIIDENGNLVNDPVVLKLDENKWW
ISIADSDVIFFAKGLASGHKFDVKIVEPVVDIMAIQGPKSFALMEKVFGKKITELKFFGF
DYFDFEGTKHLIARSGWSKQGGYEVYVENTQSGQKLYDHLFEVGKEFNVGPGCPNLIERI
ESALLSYGNDFDNNDNPFECGFDQYVSLDSDINFLGKEKLKEIKLKGPQKKLRGVKIDIK
EISLTGSKNIYDENNNVIGELRSACYSPHFQKVIGIAMIKKSHWEASQGFKIQINDNTIN
GNVCDLPFI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttttcaatagcaaaatcaagaagattaagaagtactccttatacctcaaga
atagagaaacaaggtgttacagcatacacaatatataatcatatgttgttacctgctgca
tttggatcaatagaggatagctacaaacatttaaaagaacatgttcagatatgggatgtc
gctgcagaaagacaagtagaaatatcaggaaaagactcggcagagttagtacaattgatg
acatgtcgggatctatcaaaatctaaaataggcagatgttattattgtccaataatagac
gaaaatggaaatttagttaatgacccagttgttttaaaacttgatgaaaataaatggtgg
atatcaatagcagattcggatgtaatcttttttgccaaaggcttagcatcaggacacaaa
tttgatgttaaaattgtagaaccagtagttgatattatggcaatacaaggtccaaaatcc
tttgcgttaatggaaaaagtttttggaaaaaaaattactgagctaaaattctttgggttt
gattattttgattttgaaggcacaaagcaccttatagctagatcaggatggtctaaacaa
ggaggatatgaagtatacgttgaaaacacacagtcaggacaaaaattgtatgaccatctt
tttgaagttggaaaagaatttaatgtagggccaggatgtccgaatttaatagagagaatt
gagagtgcactgttatcttatggtaatgattttgataataacgacaatccatttgaatgt
ggttttgatcaatatgttagcttagatagtgatataaattttttaggaaaagaaaaattg
aaagaaataaaattaaaaggaccccaaaaaaaattaaggggagttaaaattgatataaaa
gaaattagtcttacgggatcaaaaaacatatatgatgaaaataataatgtgattggtgaa
ttaagatcggcttgttattcacctcattttcaaaaggttataggcatagcaatgatcaag
aaatcccactgggaagcatctcaaggctttaaaattcaaataaacgataataccattaat
ggaaacgtttgtgatttacccttcatctag

DBGET integrated database retrieval system