KEGG   Candidatus Pelagibacter ubique: SAR11_0590
Entry
SAR11_0590        CDS       T00257                                 

Definition
(GenBank) 5-formyltetrahydrofolate cyclo-ligase
  KO
K01934  5-formyltetrahydrofolate cyclo-ligase [EC:6.3.3.2]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00670  One carbon pool by folate
pub01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pub00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAR11_0590
Enzymes [BR:pub01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.2  5-formyltetrahydrofolate cyclo-ligase
     SAR11_0590
SSDB
Motif
Pfam: 5-FTHF_cyc-lig LpxI_N
Other DBs
NCBI-ProteinID: AAZ21411
UniProt: Q4FN28
LinkDB
Position
577506..578054
AA seq 182 aa
MLKSELRKKILKIRKKFNTKNIQLNFKQIVKILKKEKITNQIMIGGYYPVNFEIDDLTLL
RKFKKNKFNISLPIIKKNFQMDFYSWSFSEPLKINKYGIPEPEAKNIVYPDVLLIPLVAF
DKNLNRLGYGGGYYDRLIEKLSKKKNIIKIGLAFSIQEIDKVPTNMYDKKLDYIVTNKNI
IK
NT seq 549 nt   +upstreamnt  +downstreamnt
gtgttaaaatctgaattaagaaaaaaaattcttaaaataagaaaaaaatttaatacaaaa
aatattcagctcaacttcaagcaaattgtaaaaattcttaaaaaagaaaagataaccaat
cagattatgataggtggatactaccctgtaaactttgagatagacgacttgacactgtta
agaaaatttaaaaagaataaatttaatatttctttgcccataattaagaaaaactttcaa
atggatttttattcatggtcattttctgagcccttaaaaataaataaatatggaatacct
gaaccagaagctaaaaatatagtataccctgacgttttattaattcccttggtagcattt
gataaaaatttaaacagacttggatatggtggtggatactacgatagattaattgaaaaa
ttatcaaaaaaaaaaaatatcataaagataggtttggctttttcaattcaagaaattgat
aaagtgccaactaatatgtatgataaaaaattagattatattgtaacaaataaaaatatt
ataaaatga

DBGET integrated database retrieval system