KEGG   Candidatus Pelagibacter ubique: SAR11_0666
Entry
SAR11_0666        CDS       T00257                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system protein T2
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00260  Glycine, serine and threonine metabolism
pub00630  Glyoxylate and dicarboxylate metabolism
pub00670  One carbon pool by folate
pub01100  Metabolic pathways
pub01110  Biosynthesis of secondary metabolites
pub01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAR11_0666 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR11_0666 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAR11_0666 (gcvT)
Enzymes [BR:pub01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     SAR11_0666 (gcvT)
SSDB
Motif
Pfam: GCV_T GCV_T_C
Other DBs
NCBI-ProteinID: AAZ21486
UniProt: Q4FMV3
LinkDB
Position
649954..651060
AA seq 368 aa
MDILKTALYSLHQKHGAKFVPFAGYQMPIQYSKGIIEEHKSTRENAGIFDVSHMGQLFIK
GDDKLAKDLEKIFPAELSKAKLNQSKYSFLMNDEAGIYDDLIITKVEGGFNIVLNAACKN
TDFKLLTKLLEDKYEMILSEELSLIAIQGPKAVQILEKIINGVSDLKFMNGDTFNYLKED
IYITRSGYTGEDGFEISIKNENAEVFVQKLIDEGANLIGLGARDTLRLEAGLCLYGHDMD
INKSPVEANLKWAISKNRILEGGFIGCEKIKSQIEKGVSKIRVGIKPEGRIIAREKTSIF
SEDDKNIGEITSGTFGPSVQAPVAMGYVENSFSKIDTKVFLEVRGKKYPAIISNLPFYKK
SYVKGASK
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggatattttaaaaaccgcactttacagtttacatcaaaagcatggagctaagtttgtt
ccatttgctgggtatcaaatgccaattcaatattctaaaggaattattgaggaacacaaa
agtacaagagaaaatgcaggtatttttgatgtgtcccatatgggtcagttattcattaaa
ggagatgataagttggcaaaagatcttgaaaaaatttttccagctgaattgagtaaggct
aaattaaatcaatccaaatatagttttttaatgaatgatgaagcaggaatttatgatgat
ttaattatcacaaaagttgaaggtggttttaacattgtattaaatgctgcttgtaagaat
acagattttaaacttttaactaaattgttagaagataagtatgaaatgattttaagtgaa
gagctatcgcttatagcaattcaaggtcctaaagcagtccaaatactagaaaagataatc
aacggagtgtcagatctgaaatttatgaatggtgatacgtttaattatcttaaagaggat
atttatatcacaagatcaggctataccggtgaagatggatttgagatatcgatcaaaaat
gagaacgcagaagtgtttgtgcaaaaactcatagatgaaggggctaatttaattggatta
ggtgctagagataccttgagactagaggcgggactttgtttgtatggtcatgacatggat
attaataaaagcccagtagaagcaaatttaaaatgggcgatatcaaaaaatagaattctt
gagggtgggtttattggatgtgaaaaaattaaatctcaaatcgagaaaggagtaagcaaa
atccgcgtaggtattaagccagaaggaagaattatagcccgtgaaaaaacttcaatattt
agtgaggatgataaaaatattggggaaattacaagtggaacttttggacccagcgttcag
gccccagttgcaatgggttatgtagaaaattcattttctaaaattgatactaaggttttt
ttagaagtgagaggaaaaaaatatccggcaattataagtaatttgccattttataaaaaa
agttatgtgaaaggagctagtaaatga

KEGG   Candidatus Pelagibacter ubique: SAR11_1303
Entry
SAR11_1303        CDS       T00257                                 

Definition
(GenBank) putative aminomethyltransferase protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00260  Glycine, serine and threonine metabolism
pub00630  Glyoxylate and dicarboxylate metabolism
pub00670  One carbon pool by folate
pub01100  Metabolic pathways
pub01110  Biosynthesis of secondary metabolites
pub01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAR11_1303
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR11_1303
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAR11_1303
Enzymes [BR:pub01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     SAR11_1303
SSDB
Motif
Pfam: GCV_T DUF1989 GCV_T_C FPRL1_inhibitor
Other DBs
NCBI-ProteinID: AAZ22106
UniProt: Q4FL32
LinkDB
Position
1236434..1238761
AA seq 775 aa
MLHTSKDIRSPGLRTLPPGVERYFVRGGGLSIIEVLPEDKIEIINEEGKQICEIIVFNSK
GKSDLSILNLKENSNADFSKKTISNDEKISKILKKKNLNLSNAKASIIFNDDCLMGEKIT
LTSKDKCIVMIAAPGDAMNVHEQNPPTDLTIYLNKAKFIETDEQFILPDPLSDPIIEQLV
KRRTAETYSVKAGEYIQIIDPGGRQCSDFLAFDTQKLNDGIESIIDDKTTRTFMGGAYPG
PGLFSKFYDGDHEAMIEVVRDTVGRHDTFNLACTSKYYEDMGYMGHINCTDNFNNRLDKY
DINSRKSWSAINLFFNTAIDANNVASFDEPWSRPGDYVLFRALKDLTCISSACPCDVDAA
NGWNPTDIFVRTYSKEKKYSKAIAFRMKTDSEPKLTQETGFHKKTSELTRNFVEYKGFWL
ANNFTNSGTIKEYTACRESAIATDLSPLRKFEILGPDAENLMQYTLTRNVKKLSIGQVVY
TAMCYENGCMLDDGTLFKLGQDNFRWIGGDEYSGEWLKEQAKKKNYKVWIKSATDHIHNI
AVQGPNSRKILEKFVWTAPIQPSITELEWFRFNIARIDHETGTPIVISRTGYTGELGYEI
WCHPKDAAEVWDKVWEAGKEFDITPLGLEALDMVRIEAGLIFYGYEFDDQTDPFEAGIGF
TVPLKTKEDDFIGKEELIKRKANPQKKLVGLELVGHEPALHGDCVHVGRGQVGVITSGML
SPKLGKNIALCRIDVKYSEIGTEVEIGKLDGHQKRIGAKVVPFPFYDPTKSRVRA
NT seq 2328 nt   +upstreamnt  +downstreamnt
atgctacatactagtaaagatatacgaagtcctggtttaagaacgttaccacctggagtt
gaaagatattttgtaagaggtggaggtttatcaattatagaagttttaccagaagataaa
atagaaataataaatgaagaaggaaaacaaatttgtgaaataattgtttttaattcaaaa
ggtaaatctgatttatctattttaaatttaaaagaaaattctaacgcagatttttcaaaa
aaaactatctcaaacgatgaaaaaatttcaaaaattttaaagaaaaaaaacttaaattta
agtaatgctaaagcatctatcatttttaacgatgattgcttgatgggtgaaaaaataaca
ctaacctcaaaagataaatgcattgtaatgattgctgcacctggtgatgcaatgaatgtt
catgaacaaaatcctccaacagatttaacgatttatttaaataaagctaaatttattgaa
actgatgaacaatttatcttaccagatccacttagtgatccaattatagaacaacttgta
aaaagaagaactgctgaaacctacagtgttaaagctggtgaatatattcaaataattgat
ccaggtggaagacagtgttctgattttttagcttttgatacacaaaaattaaatgacggt
attgaaagcattattgatgataaaacaacacgaacctttatgggtggtgcctaccctggg
ccaggattattttcaaagttttatgacggcgatcatgaagctatgattgaagttgtgaga
gataccgttggaagacatgatactttcaatcttgcttgcacatcaaaatactatgaagac
atgggatatatggggcacataaattgtacagataattttaataataggctggataaatat
gacatcaattctcgaaaaagctggtctgcaataaatctttttttcaatactgctattgac
gctaataatgttgcatcttttgatgagccttggtcaagaccaggggattatgttttgttt
agggctttaaaagatttaacttgtatatcctctgcttgcccatgtgatgtagatgctgca
aatggctggaatccaactgatatttttgttaggacttattcaaaggaaaaaaaatattca
aaagcaatagcatttagaatgaaaacagactcagagcctaaattaacacaagagacaggg
tttcataaaaaaacttctgagctaacaagaaattttgttgagtataaaggtttttggctt
gctaataattttacaaattcaggaacaataaaagagtatacggcttgtagagaaagtgcg
attgcaacagacttatcacctcttagaaagtttgaaattcttggacctgatgcagaaaat
ttaatgcaatacacacttactagaaatgttaaaaaactatctatcggacaagttgtttat
acagctatgtgttatgaaaatggctgtatgctagatgacggtactttatttaaattagga
caagataattttagatggatcggtggagatgaatacagtggtgaatggttaaaagaacaa
gctaagaagaaaaattacaaagtttggataaaatctgcaacagatcatattcataacatt
gccgttcaaggtccaaatagtagaaaaattttagaaaagtttgtatggacggcgccaatc
caaccatcaatcactgaacttgaatggttcagatttaatattgcaagaatagatcatgaa
acaggtacgccaattgttatttcaagaacaggttacacgggtgaacttggttatgaaata
tggtgtcatccaaaagatgctgcagaagtttgggataaagtttgggaagctggtaaagag
tttgatattaccccattaggtttagaagctttagacatggttcgtatagaagctggcctt
attttttatggttatgagtttgacgatcaaacagatccatttgaagctggaattggtttt
acagttccacttaaaactaaggaagatgattttataggtaaagaagaattaattaaaaga
aaagcaaatccacaaaaaaaattagttggtctggaattagtaggtcatgaaccggcatta
catggagattgtgttcatgtaggtcgtggtcaagtaggtgtaataacaagtggaatgcta
tcccctaaacttggaaaaaatattgcgctttgtagaatagatgtaaaatattctgagatt
ggaactgaagttgaaattggtaaacttgatggtcatcaaaaaagaattggagcgaaagtt
gtaccttttcctttctacgatccaacaaaatcaagagttagagcgtaa

DBGET integrated database retrieval system