KEGG   Candidatus Pelagibacter ubique: SAR11_0718
Entry
SAR11_0718        CDS       T00257                                 

Gene name
purN
Definition
(GenBank) phosphoribosylglycinamide formyltransferase
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00230  Purine metabolism
pub00670  One carbon pool by folate
pub01100  Metabolic pathways
pub01110  Biosynthesis of secondary metabolites
Module
pub_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:pub00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SAR11_0718 (purN)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAR11_0718 (purN)
Enzymes [BR:pub01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     SAR11_0718 (purN)
SSDB
Motif
Pfam: Formyl_trans_N DUF5494
Other DBs
NCBI-ProteinID: AAZ21537
UniProt: Q4FMQ2
LinkDB
Position
complement(701796..702374)
AA seq 192 aa
MVKLTGPKKIKTAVFISGTGSNLKNLIKFSKIKNSPISIDLIVSNTSKAKGLKFSNQFNI
KKYVSSFKNYKIAETKILNLLKKENIKFICLAGFMKILSKSFIKKFSGKIVNIHPSLLPK
YKGLDTHFKAIQNKDKVAGCTVHFVTAKLDSGKIILQKKVKISKKDTSISLAKKVLKQEH
KLYPAAIKKLFN
NT seq 579 nt   +upstreamnt  +downstreamnt
atggtaaaattgactggtcctaaaaagattaaaacagcagtatttatatctggaactgga
agtaatttaaaaaatttaataaaattttctaaaataaaaaattcacctatatctatagat
ttaattgtttcaaatacttcaaaagccaaaggtttaaaattttcaaatcaatttaatatt
aaaaaatatgtatcaagctttaaaaactataaaatagctgaaacaaaaatattaaattta
ttaaaaaaagaaaatataaagtttatttgccttgcaggctttatgaagattttatctaaa
agttttattaaaaaatttagtggaaaaatagttaatatacatccttctttactgccaaag
tataaggggcttgatactcattttaaagcaatacaaaataaagataaggtagctggttgt
actgttcattttgtaacagcgaaacttgattcaggaaaaataattctgcaaaagaaagtt
aaaatttcaaaaaaagatacttctatttctttagctaaaaaagttctaaaacaagagcac
aagctctatccagcggctataaaaaaattatttaattaa

DBGET integrated database retrieval system